PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

DCAR_002460

Organism

Daucus carota

Taxonomic ID

4039

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus

Family

NF-YB

Protein Properties

Length: 157aa MW: 17804.8 Da PI: 6.5145

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
DCAR_002460	genome	ARS-USDA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	164.3	1.6e-51	20	114	3	97
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 eqd++lPianv+rimk++lPanaki+k+ ket+qecvsefisfvt+eas+kc++e+rkt+ngdd++wa+ lGf++y++plk yl +yre+eg++ DCAR_002460 20 EQDQLLPIANVARIMKEILPANAKIAKEGKETMQECVSEFISFVTGEASEKCRKERRKTVNGDDIVWAIDRLGFDNYAQPLKRYLDRYREIEGDH 114 8*******************************************************************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.1E-48	19	121	IPR009072	Histone-fold
SuperFamily	SSF47113	2.42E-37	21	116	IPR009072	Histone-fold
Pfam	PF00808	1.1E-25	24	88	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	5.4E-18	52	70	No hit	No description
PROSITE pattern	PS00685	0	55	71	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	5.4E-18	71	89	No hit	No description
PRINTS	PR00615	5.4E-18	90	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
MTSKNSGAAG SSSKPPQPYE QDQLLPIANV ARIMKEILPA NAKIAKEGKE TMQECVSEFI 60 SFVTGEASEK CRKERRKTVN GDDIVWAIDR LGFDNYAQPL KRYLDRYREI EGDHRANMNI 120 VHDRVGYDHE GNGRFHLYVK DAQQDRMDDN HPNGDH*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-44	20	109	3	92	Transcription factor HapC (Eurofung)
4g92_B	3e-44	20	109	3	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017256989.1	1e-116	PREDICTED: nuclear transcription factor Y subunit B-5-like
Swissprot	O82248	2e-49	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
Swissprot	Q9FGJ3	6e-49	NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBL	A0A169WR86	1e-114	A0A169WR86_DAUCS; Uncharacterized protein
STRING	POPTR_0008s22520.1	3e-55	(Populus trichocarpa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	2e-51	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	DCAR_002460

Publications ? help Back to Top
Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714]