PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_002324 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 141aa MW: 15791.6 Da PI: 8.3868 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 65.1 | 1.4e-20 | 23 | 75 | 2 | 56 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56 +y+GVr+++ +g+++AeIrd s+n ++r +lg+f taeeAa+a+++a+ +l+g+ DCAR_002324 23 RYRGVRRRP-WGKYAAEIRDSSQNR-QQRLWLGTFETAEEAARAYDKAAFNLKGH 75 6********.**********66653.6*************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00847 | 9.7E-15 | 23 | 75 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 4.64E-21 | 23 | 83 | IPR016177 | DNA-binding domain |
PROSITE profile | PS51032 | 23.96 | 23 | 82 | IPR001471 | AP2/ERF domain |
CDD | cd00018 | 9.79E-28 | 23 | 82 | No hit | No description |
Gene3D | G3DSA:3.30.730.10 | 9.3E-30 | 23 | 83 | IPR001471 | AP2/ERF domain |
SMART | SM00380 | 2.4E-33 | 23 | 88 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 1.3E-11 | 24 | 35 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 1.3E-11 | 48 | 64 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MEGSSKGKNA QENKGGTGSE EVRYRGVRRR PWGKYAAEIR DSSQNRQQRL WLGTFETAEE 60 AARAYDKAAF NLKGHLAILN FPREYYSKLP SYIYPPGPCS SVSPSSSVSD GKQIIEFEYL 120 DDSVMDELLE SEAEKIKSKK * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5wx9_A | 2e-34 | 16 | 140 | 7 | 130 | Ethylene-responsive transcription factor ERF096 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017223341.1 | 1e-100 | PREDICTED: ethylene-responsive transcription factor ERF098 | ||||
Swissprot | Q9LTC5 | 4e-43 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
TrEMBL | A0A166H3A8 | 2e-98 | A0A166H3A8_DAUCS; Uncharacterized protein | ||||
STRING | XP_009590142.1 | 3e-47 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA21 | 24 | 1165 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23230.1 | 2e-33 | ERF family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_002324 |
Publications ? help Back to Top | |||
---|---|---|---|
|