| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 160.1 | 8.6e-50 | 10 | 138 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97
lppGfrF P+deelv++yL kk++++++ ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat++gyWkatgkd+ vl+ ++
DCAR_000935 10 LPPGFRFYPSDEELVCHYLFKKIAKEEVLK-GTLVEIDLHTCEPWQLPEVAKLNSTEWYFFSFRDRKYATGFRTNRATTTGYWKATGKDRVVLDPkTN 106
79************************9655.78***************88888999*************************************98566 PP
NAM 98 elvglkktLvfykgrapkgektdWvmheyrle 129
+ vg++ktLvfyk+rap+g+kt W+mhe+rle
DCAR_000935 107 AIVGMRKTLVFYKNRAPNGVKTGWIMHEFRLE 138
77***************************985 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1ut4_A | 1e-46 | 10 | 159 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-46 | 10 | 159 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-46 | 10 | 159 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-46 | 10 | 159 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-46 | 10 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swm_B | 2e-46 | 10 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swm_C | 2e-46 | 10 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swm_D | 2e-46 | 10 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_A | 2e-46 | 10 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_B | 2e-46 | 10 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_C | 2e-46 | 10 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_D | 2e-46 | 10 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 4dul_A | 1e-46 | 10 | 159 | 17 | 168 | NAC domain-containing protein 19 |
| 4dul_B | 1e-46 | 10 | 159 | 17 | 168 | NAC domain-containing protein 19 |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
| UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
| Publications
? help Back to Top |
- Le Hénanff G, et al.
Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
J. Exp. Bot., 2013. 64(16): p. 4877-93
[PMID:24043850] - Wang YX
Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
Mol. Biol. Rep., 2013. 40(11): p. 6451-8
[PMID:24057250] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development.
Front Plant Sci, 2014. 5: p. 165
[PMID:24817871] - Gonçalves B, et al.
A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
Plant J., 2015. 83(4): p. 732-42
[PMID:26119568] - Xiao D, et al.
SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
Plant Physiol., 2015. 169(2): p. 1275-91
[PMID:26304848] - Du Q,Wang H
The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
Plant Signal Behav, 2015. 10(10): p. e1078955
[PMID:26340415] - Huo X,Wang C,Teng Y,Liu X
Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
BMC Plant Biol., 2015. 15: p. 266
[PMID:26530097] - Vialette-Guiraud AC, et al.
A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids.
Front Plant Sci, 2015. 6: p. 1239
[PMID:26793217] - Chen X, et al.
Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
Plant Physiol., 2016. 170(4): p. 2136-45
[PMID:26850273] - Cui X, et al.
REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis.
Nat. Genet., 2016. 48(6): p. 694-9
[PMID:27111035] - Blein T,Pautot V,Laufs P
Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
Plants (Basel), 2013. 2(2): p. 230-47
[PMID:27137374] - Biot E, et al.
Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis.
Development, 2016. 143(18): p. 3417-28
[PMID:27387872] - Zheng M, et al.
Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development.
Plant Physiol., 2016. 172(2): p. 1117-1130
[PMID:27535792] - Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
Plant J., 2017. 90(3): p. 435-446
[PMID:28161901] - Koyama T,Sato F,Ohme-Takagi M
Roles of miR319 and TCP Transcription Factors in Leaf Development.
Plant Physiol., 2017. 175(2): p. 874-885
[PMID:28842549] - González-Carranza ZH, et al.
HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression.
PLoS ONE, 2017. 12(9): p. e0185106
[PMID:28934292] - Liu C,Wang B,Li Z,Peng Z,Zhang J
TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
Plant Physiol., 2018. 176(1): p. 742-756
[PMID:29122985] - Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL
Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves.
New Phytol., 2018. 217(3): p. 1307-1321
[PMID:29139551] - Gonçalves B, et al.
GDP-L-fucose is required for boundary definition in plants.
J. Exp. Bot., 2017. 68(21-22): p. 5801-5811
[PMID:29186469] - Sha S, et al.
To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes.
Ann. Bot., 2018. 121(2): p. 255-266
[PMID:29267935] - Maugarny-Calès A, et al.
Dissecting the pathways coordinating patterning and growth by plant boundary domains.
PLoS Genet., 2019. 15(1): p. e1007913
[PMID:30677017]
|
