PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

orange1.1g046045m

Common Name

CISIN_1g046045mg

Organism

Citrus sinensis

Taxonomic ID

2711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

YABBY

Protein Properties

Length: 119aa MW: 13159.1 Da PI: 10.4352

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g046045m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	100.7	3.1e-31	1	119	24	159
YABBY 24 vsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppv 115 v +P + l+ +vtv+CGhC++l ++ + + + + l+++e++ n+ k +as+s ss ++++ +p++p v orange1.1g046045m 1 VGIPCKRLLDTVTVKCGHCSNLSFLSTRPPP-QGP------------SQMSLRFQEKQSFCNDFKLGNASSSSSS----TSSEPLSPKAPFV 75 67999**************98553333222.222............3344566666666666666666655554....456677899999 PP YABBY 116 irPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159 ++PPek+ r Psaynrf+keeiqrika+nP+i hreafs+aakn orange1.1g046045m 76 VKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSTAAKN 119 *******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.2E-38	1	119	IPR006780	YABBY protein
SuperFamily	SSF47095	2.88E-7	67	117	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010254	Biological Process	nectary development
GO:0010582	Biological Process	floral meristem determinacy
GO:0048479	Biological Process	style development

Sequence ? help Back to Top
Protein Sequence Length: 119 aa Download sequence Send to blast
VGIPCKRLLD TVTVKCGHCS NLSFLSTRPP PQGPSQMSLR FQEKQSFCND FKLGNASSSS 60 SSTSSEPLSP KAPFVVKPPE KKHRLPSAYN RFMKEEIQRI KAANPEIPHR EAFSTAAKN

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269\|PubMed:14729915}.

Functional Description ? help Back to Top
Source	Description
UniProt	Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269\|PubMed:14729915}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00220	DAP	Transfer from AT1G69180	Download

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006484236.1	2e-81	protein CRABS CLAW
Swissprot	Q76EJ0	4e-46	YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBL	A0A067G4F2	3e-81	A0A067G4F2_CITSI; Uncharacterized protein (Fragment)
STRING	XP_006484236.1	9e-81	(Citrus sinensis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM9725	28	35

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69180.1	7e-45	YABBY family protein

Link Out ? help Back to Top
Phytozome	orange1.1g046045m