PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g045160m | ||||||||
Common Name | CISIN_1g045160mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 167aa MW: 19283.8 Da PI: 7.0588 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.2 | 3.8e-10 | 109 | 143 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp+++++ +LA+++gL+++q+ +WF N+R ++ orange1.1g045160m 109 KWPYPTEADKLQLAESTGLDQKQINNWFINQRKRH 143 569*****************************985 PP | |||||||
2 | ELK | 29.9 | 1.2e-10 | 64 | 84 | 2 | 22 |
ELK 2 LKhqLlrKYsgyLgsLkqEFs 22 LK+ LlrK+++++gsLk EFs orange1.1g045160m 64 LKDKLLRKFGSHIGSLKLEFS 84 9*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 9.114 | 63 | 83 | IPR005539 | ELK domain |
SMART | SM01188 | 3.0E-5 | 63 | 84 | IPR005539 | ELK domain |
Pfam | PF03789 | 9.7E-8 | 64 | 84 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 13.183 | 83 | 146 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 6.84E-21 | 84 | 159 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 3.5E-13 | 85 | 150 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 6.6E-29 | 88 | 147 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 7.76E-13 | 95 | 147 | No hit | No description |
Pfam | PF05920 | 9.8E-19 | 103 | 142 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 121 | 144 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MMCLYLPFAA WLSFFFEFII NPSEGCTGLK FSNTKDGAAS SDEEYSGAET EAQDAEARDE 60 DRHLKDKLLR KFGSHIGSLK LEFSKKKKKG KLPKESRQTL LDWWNAHYKW PYPTEADKLQ 120 LAESTGLDQK QINNWFINQR KRHWKPSENM HFAVMDNLSG PLFTDD* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First detected in torpedo stage embryos at the boundaries between the presumptive SAM and the cotyledons. Later expressed between the cotyledons and the meristem, and between the cotyledons. In seedlings, localised in stipules and at the boundaries between the SAM and the emerging primordia. Expressed at the site of lateral roots. {ECO:0000269|PubMed:16798887}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed predominantly in shoot apices of seedlings, and, to a lower extent, in rosette leaves. {ECO:0000269|PubMed:11311158}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006483907.1 | 5e-83 | homeobox protein knotted-1-like 6 isoform X1 | ||||
Refseq | XP_024956251.1 | 5e-83 | homeobox protein knotted-1-like 6 isoform X2 | ||||
Swissprot | Q84JS6 | 1e-62 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A067H447 | 1e-120 | A0A067H447_CITSI; Uncharacterized protein | ||||
STRING | XP_006438318.1 | 5e-92 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM835 | 27 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.2 | 3e-55 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g045160m |
Publications ? help Back to Top | |||
---|---|---|---|
|