PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g044864m | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 215aa MW: 24178.3 Da PI: 8.683 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.7 | 1.3e-18 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++l+d+++++G g+W+tI++ g+ R++k+c++rw +yl orange1.1g044864m 13 KGAWSKQEDQKLIDYIRKHGEGCWRTIPQAAGLARCGKSCRLRWINYL 60 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.7 | 2e-16 | 66 | 111 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l orange1.1g044864m 66 RGNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTANEVKNYWNSHL 111 8999******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.0E-25 | 4 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.248 | 8 | 60 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.49E-29 | 11 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.1E-14 | 12 | 62 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.5E-17 | 13 | 60 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.99E-11 | 15 | 60 | No hit | No description |
PROSITE profile | PS51294 | 26.525 | 61 | 115 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-25 | 64 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-15 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-15 | 66 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.91E-11 | 68 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MRKPCCDKQD TNKGAWSKQE DQKLIDYIRK HGEGCWRTIP QAAGLARCGK SCRLRWINYL 60 RPDLKRGNFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTA NEVKNYWNSH LRRKLINMGI 120 DPKNHRLHHS LPHNSTGATS LGQQLVDMNE PAVKPRGDDI YQASDAGSCW EDEPCRLLPD 180 LNLDLTMSIP SSSSSPSLAN KANTEKKNDS ELPN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-29 | 10 | 115 | 4 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ126857 | 1e-108 | KJ126857.1 Malus hybrid cultivar MYB2 (MYB2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006448287.1 | 1e-157 | myb-related protein 308 | ||||
Refseq | XP_006495052.1 | 1e-157 | myb-related protein 308 | ||||
Swissprot | P81393 | 1e-73 | MYB08_ANTMA; Myb-related protein 308 | ||||
Swissprot | Q9SZP1 | 1e-73 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | A0A2H5PQP2 | 1e-156 | A0A2H5PQP2_CITUN; Uncharacterized protein | ||||
TrEMBL | V4U6E9 | 1e-156 | V4U6E9_9ROSI; Uncharacterized protein | ||||
STRING | XP_006495052.1 | 1e-157 | (Citrus sinensis) | ||||
STRING | XP_006448287.1 | 1e-157 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09460.1 | 9e-75 | myb domain protein 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g044864m |