PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g043591m | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 96aa MW: 10215.4 Da PI: 8.0522 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104.3 | 7.9e-33 | 26 | 82 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa +Gg+avDGC+Efm+s geegtaaal+CaACgCHR+FHRrev++e orange1.1g043591m 26 SVRYAECQKNHAAGVGGYAVDGCREFMAS-GEEGTAAALTCAACGCHRSFHRREVDTE 82 79**************************9.999*********************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 5.0E-18 | 1 | 92 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.9E-30 | 27 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 3.3E-27 | 28 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.118 | 29 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MRKRQVVLRR EEPSRNSTAS SVTVRSVRYA ECQKNHAAGV GGYAVDGCRE FMASGEEGTA 60 AALTCAACGC HRSFHRREVD TEVVCECSSP SSTAT* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.4038 | 1e-145 | flower| fruit| seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006482592.1 | 3e-63 | mini zinc finger protein 2 isoform X1 | ||||
Refseq | XP_024037858.1 | 3e-63 | mini zinc finger protein 2 | ||||
Swissprot | Q9LJW5 | 8e-44 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | V4T4C3 | 2e-62 | V4T4C3_9ROSI; Uncharacterized protein | ||||
STRING | XP_006431146.1 | 4e-63 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM944 | 28 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 2e-26 | mini zinc finger 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g043591m |
Publications ? help Back to Top | |||
---|---|---|---|
|