PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

orange1.1g041198m

Common Name

CISIN_1g041198mg

Organism

Citrus sinensis

Taxonomic ID

2711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

bHLH

Protein Properties

Length: 94aa MW: 10495.8 Da PI: 9.2494

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g041198m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	30.1	8.5e-10	20	60	14	54
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+i + ++L++l+P++ + +s K+s + iL+++++YI+sL orange1.1g041198m 20 DQIGDLVSKLQQLIPELRSRRSDKVSASKILQETCDYIRSL 60 57778889******779******************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	11.064	6	60	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	2.75E-10	19	81	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	6.8E-10	20	77	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	3.1E-7	20	60	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009416	Biological Process	response to light stimulus
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MSSRRSRSRQ SSGVSRISYD QIGDLVSKLQ QLIPELRSRR SDKVSASKIL QETCDYIRSL 60 HREVDDLSDR LSELLASIDS NSAEAAIIRS LLM*

Functional Description ? help Back to Top
Source	Description
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269\|PubMed:16786307, ECO:0000269\|PubMed:23224238}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269\|PubMed:16786307}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006438657.1	3e-55	transcription factor PRE6
Refseq	XP_006483196.1	3e-55	transcription factor PRE6-like
Refseq	XP_006483197.1	3e-55	transcription factor PRE6-like
Refseq	XP_006495343.1	3e-55	transcription factor PRE6-like
Swissprot	Q8GW32	1e-38	PRE6_ARATH; Transcription factor PRE6
TrEMBL	A0A067H5P2	2e-55	A0A067H5P2_CITSI; Uncharacterized protein
STRING	XP_006483196.1	1e-54	(Citrus sinensis)
STRING	XP_006483197.1	1e-54	(Citrus sinensis)
STRING	XP_006495343.1	1e-54	(Citrus sinensis)
STRING	XP_006438657.1	1e-54	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM259	28	225

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26945.1	8e-41	bHLH family protein

Link Out ? help Back to Top
Phytozome	orange1.1g041198m

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Gommers CM, et al. Molecular Profiles of Contrasting Shade Response Strategies in Wild Plants: Differential Control of Immunity and Shoot Elongation. Plant Cell, 2017. 29(2): p. 331-344 [PMID:28138015] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Zheng K, et al. Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis. Front Plant Sci, 2017. 8: p. 1813 [PMID:29114256]