PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g041165m | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 85aa MW: 9949.71 Da PI: 8.789 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.3 | 8.5e-14 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd +l + G ++W+ +++ g+ R++k+c++rw +yl orange1.1g041165m 14 RGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYL 61 89******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.604 | 9 | 65 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.6E-19 | 12 | 60 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-5 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-12 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.42E-19 | 15 | 84 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.75E-5 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.6E-7 | 61 | 83 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.286 | 66 | 85 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MGRQPCCDKV GLKRGPWTIE EDHKLMSFIL NNGIHCWRMV PKLAGLLRCG KSCRLRWINY 60 LRPDLKRGAF TEDEEDQIIQ LHSLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 8e-14 | 12 | 85 | 5 | 77 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: High rates of growth. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator. | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006447177.1 | 5e-58 | myb-related protein 315 | ||||
Refseq | XP_024950783.1 | 5e-58 | myb-related protein 315-like | ||||
Swissprot | P80073 | 8e-42 | MYB2_PHYPA; Myb-related protein Pp2 | ||||
Swissprot | Q9LTC4 | 7e-43 | MYB15_ARATH; Transcription factor MYB15 | ||||
TrEMBL | V4U3C8 | 1e-56 | V4U3C8_9ROSI; Uncharacterized protein | ||||
STRING | XP_006470116.1 | 2e-57 | (Citrus sinensis) | ||||
STRING | EOY02629 | 5e-56 | (Theobroma cacao) | ||||
STRING | XP_006447177.1 | 2e-57 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14340.1 | 3e-53 | myb domain protein 40 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g041165m |