PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g041165m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 85aa    MW: 9949.71 Da    PI: 8.789
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g041165mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.5e-141461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT eEd +l   +   G ++W+ +++  g+ R++k+c++rw +yl
  orange1.1g041165m 14 RGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYL 61
                       89******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.604965IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-191260IPR009057Homeodomain-like
SMARTSM007171.1E-51363IPR001005SANT/Myb domain
PfamPF002498.3E-121461IPR001005SANT/Myb domain
SuperFamilySSF466892.42E-191584IPR009057Homeodomain-like
CDDcd001672.75E-51661No hitNo description
Gene3DG3DSA:1.10.10.602.6E-76183IPR009057Homeodomain-like
PROSITE profilePS512947.2866685IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MGRQPCCDKV GLKRGPWTIE EDHKLMSFIL NNGIHCWRMV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGAF TEDEEDQIIQ LHSLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-141285577B-MYB
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: High rates of growth.
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}.
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator.
UniProtTranscription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447177.15e-58myb-related protein 315
RefseqXP_024950783.15e-58myb-related protein 315-like
SwissprotP800738e-42MYB2_PHYPA; Myb-related protein Pp2
SwissprotQ9LTC47e-43MYB15_ARATH; Transcription factor MYB15
TrEMBLV4U3C81e-56V4U3C8_9ROSI; Uncharacterized protein
STRINGXP_006470116.12e-57(Citrus sinensis)
STRINGEOY026295e-56(Theobroma cacao)
STRINGXP_006447177.12e-57(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.13e-53myb domain protein 40
Publications ? help Back to Top
  1. Schnaubelt D, et al.
    Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana.
    Plant Cell Environ., 2015. 38(2): p. 266-79
    [PMID:24329757]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ma X, et al.
    CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana.
    Plant Mol. Biol., 2015. 88(3): p. 287-99
    [PMID:25948280]
  4. Kim SH, et al.
    Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis.
    Nucleic Acids Res., 2017. 45(11): p. 6613-6627
    [PMID:28510716]
  5. Chezem WR,Memon A,Li FS,Weng JK,Clay NK
    SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(8): p. 1907-1926
    [PMID:28733420]
  6. Pal S, et al.
    TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation.
    Plant Physiol., 2017. 175(2): p. 916-926
    [PMID:28827455]