PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g038129m | ||||||||
Common Name | CISIN_1g038129mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 119aa MW: 13276.3 Da PI: 7.7578 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 124.2 | 6.8e-39 | 1 | 100 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +CaaC++lrr+C++dC++apyfpa++p++fa+vhk++G s+v ++l++lp e r +a+++++ eAe+r++dPvyG+v++i+ lqqq++++++ orange1.1g038129m 1 RCAACRHLRRRCPSDCIFAPYFPANDPHRFACVHKIYGSSKVGNMLQDLPVELRAEAADAICIEAECRVQDPVYGCVRMISLLQQQIHNAES 92 6******************************************************************************************* PP DUF260 93 elallkee 100 +l+++++e orange1.1g038129m 93 QLVKARAE 100 ***99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 2.5E-38 | 1 | 98 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 23.329 | 1 | 101 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
RCAACRHLRR RCPSDCIFAP YFPANDPHRF ACVHKIYGSS KVGNMLQDLP VELRAEAADA 60 ICIEAECRVQ DPVYGCVRMI SLLQQQIHNA ESQLVKARAE IAVLGSHAQE LRHHVQDI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-33 | 2 | 101 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-33 | 2 | 101 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00381 | DAP | Transfer from AT3G26620 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006490469.1 | 1e-82 | LOB domain-containing protein 23-like | ||||
Swissprot | P59467 | 6e-47 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
Swissprot | P59468 | 7e-47 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A2H5NM26 | 2e-81 | A0A2H5NM26_CITUN; Uncharacterized protein | ||||
STRING | XP_006490469.1 | 4e-82 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26620.1 | 9e-32 | LOB domain-containing protein 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g038129m |