PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g037457m | ||||||||
Common Name | CISIN_1g037457mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 75aa MW: 8932.35 Da PI: 6.7752 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 23.5 | 1.6e-07 | 6 | 49 | 4 | 49 |
NAM 4 GfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 frFhP ee++ + L++k + ++++ ++i +vd y+++P++L orange1.1g037457m 6 SFRFHPAGEEII-NLLNEKGLDPDFSV-QTIYKVDKYYFDPRQLFC 49 69**********.99*********999.88**************63 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.48E-7 | 3 | 51 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MGYLLSFRFH PAGEEIINLL NEKGLDPDFS VQTIYKVDKY YFDPRQLFCK YHHLAITLQQ 60 FTEFMVFLRA WSCF* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024045628.1 | 3e-25 | uncharacterized protein LOC112100394 isoform X3 | ||||
TrEMBL | A0A067FR74 | 6e-49 | A0A067FR74_CITSI; Uncharacterized protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g037457m |