PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g037152m
Organism
Citrus sinensis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GATA
Protein Properties Length: 76aa    MW: 8739.19 Da    PI: 10.6613
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g037152mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.32.4e-191044135
               GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                       Cs+C t +Tp+WR gp g+ktLCnaCG++y++ +l
  orange1.1g037152m 10 CSHCETRHTPQWRVGPLGPKTLCNACGVRYKSGRL 44
                       *******************************9986 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.3E-13454IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.75E-15767No hitNo description
PROSITE profilePS5011411.372840IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.2E-15842IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.30E-13958No hitNo description
PfamPF003204.4E-171044IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MNEELWQRKC SHCETRHTPQ WRVGPLGPKT LCNACGVRYK SGRLLPEYRP AASPTFDVHI  60
HSNFHRKILK KKKGI*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in stems, flowers and leaves. {ECO:0000269|PubMed:12139008}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves, less expressed in dark than in light. {ECO:0000269|PubMed:12139008}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432141.13e-51GATA transcription factor 7
RefseqXP_015384390.13e-51GATA transcription factor 7-like
SwissprotQ8L4M62e-32GATA3_ARATH; GATA transcription factor 3
SwissprotQ9SV306e-32GATA8_ARATH; GATA transcription factor 8
TrEMBLV4T7466e-50V4T746_9ROSI; Uncharacterized protein
STRINGXP_006432141.11e-50(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57392647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34680.21e-34GATA transcription factor 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Choi D, et al.
    iNID: an analytical framework for identifying network models for interplays among developmental signaling in Arabidopsis.
    Mol Plant, 2014. 7(5): p. 792-813
    [PMID:24380880]
  3. Li T,Wu XY,Li H,Song JH,Liu JY
    A Dual-Function Transcription Factor, AtYY1, Is a Novel Negative Regulator of the Arabidopsis ABA Response Network.
    Mol Plant, 2016. 9(5): p. 650-661
    [PMID:26961720]