PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g036998m | ||||||||
Common Name | CISIN_1g036998mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 265aa MW: 30022.3 Da PI: 5.2157 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 182.9 | 7.6e-57 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeelv +yL +k++g+++el e+i+e+d+yk+ePwdLp k + +++ ewyfFs+rdkky++g+r+nrat++gyWkatgkd+ orange1.1g036998m 6 LPPGFRFHPTDEELVAYYLDRKINGRTIEL-EIIPEIDLYKHEPWDLPdKsYLPGKDMEWYFFSPRDKKYPNGSRTNRATRAGYWKATGKDR 96 79****************************.99**************95335556888********************************** PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +v+s +++ vg+kktLv+y+grap+g +t+Wvmheyrl orange1.1g036998m 97 TVHS-HKQSVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133 ****.999****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.53E-64 | 3 | 157 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.989 | 6 | 157 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.7E-30 | 7 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 265 aa Download sequence Send to blast |
MAPMSLPPGF RFHPTDEELV AYYLDRKING RTIELEIIPE IDLYKHEPWD LPDKSYLPGK 60 DMEWYFFSPR DKKYPNGSRT NRATRAGYWK ATGKDRTVHS HKQSVGMKKT LVYYRGRAPH 120 GIRTNWVMHE YRLLDPLSGA ASSSLKDSYA LCRVFKKTIQ IPKAKESLQE AMGNNNNDAE 180 NQTETVGFSS DEQMLGDDTS GREAEENDYS KFPSDTSSSD FTQATPTEAG NVNADEFQAP 240 FISDEANSAV NMYSLGVDFT TNLIQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 9e-62 | 1 | 157 | 12 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 9e-62 | 1 | 157 | 12 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 9e-62 | 1 | 157 | 12 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 9e-62 | 1 | 157 | 12 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 9e-62 | 1 | 157 | 15 | 168 | NAC domain-containing protein 19 |
3swm_B | 9e-62 | 1 | 157 | 15 | 168 | NAC domain-containing protein 19 |
3swm_C | 9e-62 | 1 | 157 | 15 | 168 | NAC domain-containing protein 19 |
3swm_D | 9e-62 | 1 | 157 | 15 | 168 | NAC domain-containing protein 19 |
3swp_A | 9e-62 | 1 | 157 | 15 | 168 | NAC domain-containing protein 19 |
3swp_B | 9e-62 | 1 | 157 | 15 | 168 | NAC domain-containing protein 19 |
3swp_C | 9e-62 | 1 | 157 | 15 | 168 | NAC domain-containing protein 19 |
3swp_D | 9e-62 | 1 | 157 | 15 | 168 | NAC domain-containing protein 19 |
4dul_A | 9e-62 | 1 | 157 | 12 | 165 | NAC domain-containing protein 19 |
4dul_B | 9e-62 | 1 | 157 | 12 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00205 | DAP | Transfer from AT1G54330 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC187861 | 2e-37 | AC187861.2 Populus trichocarpa clone Pop1-1A4, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006422300.1 | 0.0 | NAC domain-containing protein 45 | ||||
Refseq | XP_006493742.1 | 0.0 | NAC domain-containing protein 45 | ||||
Swissprot | Q9FFI5 | 1e-85 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
TrEMBL | A0A067F2E6 | 0.0 | A0A067F2E6_CITSI; Uncharacterized protein (Fragment) | ||||
TrEMBL | A0A2H5NQR0 | 0.0 | A0A2H5NQR0_CITUN; Uncharacterized protein | ||||
TrEMBL | V4S9K7 | 0.0 | V4S9K7_9ROSI; Uncharacterized protein | ||||
STRING | XP_006493742.1 | 0.0 | (Citrus sinensis) | ||||
STRING | XP_006422300.1 | 0.0 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8123 | 26 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54330.1 | 3e-99 | NAC domain containing protein 20 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g036998m |
Publications ? help Back to Top | |||
---|---|---|---|
|