PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g035552m | ||||||||
Common Name | CISIN_1g035552mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 70aa MW: 8111.2 Da PI: 4.9692 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 32.8 | 1.2e-10 | 13 | 65 | 32 | 86 |
--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS B3 32 esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 s +l+ ++g W+v + rk g+++l +GW+eF + + +++g +vvF++++ orange1.1g035552m 13 LSSVARLTVPNGYIWRVDI--RKDEGKVWLDDGWQEFMEYHLICVGFSVVFQYEK 65 445789999**********..*******************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 10.588 | 1 | 69 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 4.9E-10 | 7 | 65 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 2.7E-10 | 8 | 68 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.5E-7 | 13 | 65 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 70 aa Download sequence Send to blast |
YSATVRAKFG DELSSVARLT VPNGYIWRVD IRKDEGKVWL DDGWQEFMEY HLICVGFSVV 60 FQYEKISNF* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006494701.1 | 9e-21 | B3 domain-containing transcription factor VRN1-like | ||||
TrEMBL | A0A067D935 | 3e-44 | A0A067D935_CITSI; Uncharacterized protein (Fragment) | ||||
STRING | XP_006494701.1 | 3e-20 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1591 | 25 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18990.1 | 1e-18 | B3 family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g035552m |