PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g035470m | ||||||||
Common Name | CISIN_1g035470mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 63aa MW: 7140.34 Da PI: 10.9212 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 101.3 | 3.6e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+ orange1.1g035470m 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYST 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.52 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.05E-36 | 2 | 61 | No hit | No description |
SuperFamily | SSF55455 | 8.11E-30 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 63 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYSTD 60 SW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-21 | 1 | 60 | 1 | 61 | MEF2C |
5f28_B | 2e-21 | 1 | 60 | 1 | 61 | MEF2C |
5f28_C | 2e-21 | 1 | 60 | 1 | 61 | MEF2C |
5f28_D | 2e-21 | 1 | 60 | 1 | 61 | MEF2C |
6byy_A | 2e-21 | 1 | 60 | 1 | 61 | MEF2 CHIMERA |
6byy_B | 2e-21 | 1 | 60 | 1 | 61 | MEF2 CHIMERA |
6byy_C | 2e-21 | 1 | 60 | 1 | 61 | MEF2 CHIMERA |
6byy_D | 2e-21 | 1 | 60 | 1 | 61 | MEF2 CHIMERA |
6bz1_A | 2e-21 | 1 | 60 | 1 | 61 | MEF2 CHIMERA |
6bz1_B | 2e-21 | 1 | 60 | 1 | 61 | MEF2 CHIMERA |
6bz1_C | 2e-21 | 1 | 60 | 1 | 61 | MEF2 CHIMERA |
6bz1_D | 2e-21 | 1 | 60 | 1 | 61 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.734 | 4e-97 | flower| fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in tendrils and flowers. {ECO:0000269|PubMed:15247405}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB218612 | 4e-94 | AB218612.1 Citrus unshiu CitMADS5 mRNA for MADS-box protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017973951.1 | 1e-36 | PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform X3 | ||||
Refseq | XP_021615011.1 | 1e-36 | truncated transcription factor CAULIFLOWER A-like isoform X1 | ||||
Swissprot | Q6E6S7 | 1e-36 | AP1_VITVI; Agamous-like MADS-box protein AP1 | ||||
TrEMBL | A0A438E383 | 1e-37 | A0A438E383_VITVI; Agamous-like MADS-box protein AGL8 | ||||
STRING | XP_004172815.1 | 3e-38 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 1e-38 | AGAMOUS-like 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g035470m |
Publications ? help Back to Top | |||
---|---|---|---|
|