PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g034429m | ||||||||
Common Name | CISIN_1g034429mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 96aa MW: 10598.9 Da PI: 4.8793 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 82.8 | 5.1e-26 | 20 | 78 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl k+y++++d++++e++sws+n+nsfvv+++ efa+ +Lp+yFkh+nf+SF+RQLn+Y orange1.1g034429m 20 FLIKTYDMVDDSSTDEIVSWSDNKNSFVVWNPPEFARLLLPTYFKHNNFSSFIRQLNTY 78 9********************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00415 | 1.4E-26 | 16 | 93 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 1.6E-27 | 16 | 79 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 9.53E-26 | 16 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 8.0E-22 | 20 | 78 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.8E-15 | 20 | 43 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.8E-15 | 58 | 70 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.8E-15 | 71 | 83 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
METSAASGGP GGLGGGPAPF LIKTYDMVDD SSTDEIVSWS DNKNSFVVWN PPEFARLLLP 60 TYFKHNNFSS FIRQLNTYVQ IIINKSFLWN HDNAV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 4e-17 | 9 | 78 | 17 | 87 | Heat shock factor protein 1 |
5d5v_B | 4e-17 | 9 | 78 | 17 | 87 | Heat shock factor protein 1 |
5d5v_D | 4e-17 | 9 | 78 | 17 | 87 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006492535.1 | 3e-50 | heat stress transcription factor A-5 | ||||
Swissprot | Q7XHZ0 | 2e-29 | HFB4B_ORYSJ; Heat stress transcription factor B-4b | ||||
Swissprot | Q94BZ5 | 2e-29 | HSFA5_ARATH; Heat stress transcription factor A-5 | ||||
TrEMBL | A0A067DGG8 | 5e-64 | A0A067DGG8_CITSI; Uncharacterized protein | ||||
STRING | XP_006492535.1 | 1e-49 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM965 | 28 | 111 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G13980.1 | 3e-31 | HSF family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g034429m |
Publications ? help Back to Top | |||
---|---|---|---|
|