PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g032937m | ||||||||
Common Name | CISIN_1g032937mg, LOC102609891 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 131aa MW: 14726.4 Da PI: 8.4987 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 134.5 | 3.4e-42 | 38 | 115 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +C ve+C +dl++a++yhrrhkvCe+hskapvv+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++a orange1.1g032937m 38 CCMVEKCGTDLTDARRYHRRHKVCETHSKAPVVIVAGLRQRFCQQCSRFHELYEFDETKRSCRRRLAGHNERRRKSTA 115 6**************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 4.5E-56 | 1 | 125 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 1.4E-34 | 33 | 100 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.317 | 36 | 113 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.49E-39 | 37 | 117 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.8E-32 | 39 | 112 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MDNDMEEEEG GVDCYADDER KKKATGRRAA PAGTSSPCCM VEKCGTDLTD ARRYHRRHKV 60 CETHSKAPVV IVAGLRQRFC QQCSRFHELY EFDETKRSCR RRLAGHNERR RKSTAETTGE 120 GSSCRGVGPQ * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-34 | 39 | 112 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.11995 | 0.0 | seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00359 | DAP | Transfer from AT3G15270 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006451806.1 | 1e-91 | squamosa promoter-binding-like protein 13 | ||||
Refseq | XP_006464784.1 | 1e-91 | squamosa promoter-binding-like protein 13 | ||||
Swissprot | Q38740 | 1e-41 | SBP2_ANTMA; Squamosa promoter-binding protein 2 | ||||
Swissprot | Q6Z461 | 1e-41 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
TrEMBL | A0A067FH62 | 3e-90 | A0A067FH62_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A2H5QHN5 | 3e-90 | A0A2H5QHN5_CITUN; Uncharacterized protein | ||||
TrEMBL | V4URD2 | 3e-90 | V4URD2_9ROSI; Squamosa promoter-binding protein 1 | ||||
STRING | XP_006464784.1 | 6e-91 | (Citrus sinensis) | ||||
STRING | XP_006451806.1 | 6e-91 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 2e-42 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g032937m |
Entrez Gene | 102609891 |
Publications ? help Back to Top | |||
---|---|---|---|
|