PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g032773m | ||||||||
Common Name | CISIN_1g030547mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 135aa MW: 14869 Da PI: 9.6894 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 90.6 | 1.6e-28 | 27 | 82 | 43 | 98 |
NF-YB 43 isfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 sf+++ asdkcq+ekrktingddllwa+atlGfedy++plk+yl++yre+eg++k orange1.1g032773m 27 FSFLSCRASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKAYLMRYREMEGDTK 82 59***************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51257 | 6 | 1 | 32 | No hit | No description |
PRINTS | PR00615 | 2.2E-11 | 19 | 37 | No hit | No description |
SuperFamily | SSF47113 | 7.68E-19 | 27 | 91 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 5.5E-23 | 28 | 91 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-6 | 28 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.2E-11 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 2.2E-11 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MARSLRMLRI LYRNVSLSSS ASLPASFSFL SCRASDKCQK EKRKTINGDD LLWAMATLGF 60 EDYIDPLKAY LMRYREMEGD TKGSARGGDG SAKRDTIGAL PGQNAQYALQ GPLNYANPHV 120 TFSLLHLISF LLTN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-17 | 28 | 76 | 45 | 93 | NF-YB |
4awl_B | 1e-17 | 28 | 76 | 46 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-17 | 28 | 76 | 46 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.4816 | 1e-140 | flower| fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006436200.1 | 7e-62 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_006485940.1 | 7e-62 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | Q8VYK4 | 6e-41 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A067DNX7 | 2e-94 | A0A067DNX7_CITSI; Uncharacterized protein | ||||
STRING | XP_006485940.1 | 3e-61 | (Citrus sinensis) | ||||
STRING | XP_006436200.1 | 3e-61 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 9e-41 | nuclear factor Y, subunit B8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g032773m |
Publications ? help Back to Top | |||
---|---|---|---|
|