PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g030909m | ||||||||
Common Name | CISIN_1g030909mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 170aa MW: 19146 Da PI: 10.2763 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 47.1 | 7.7e-15 | 18 | 63 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 lppGfrFhP+d+elv++yL kkv++++ ++ ++ vd++k+ePwd+p orange1.1g030909m 18 LPPGFRFHPRDDELVCDYLMKKVTHTNESI--LLAAVDLNKCEPWDIP 63 79**********************999666..79************98 PP | |||||||
2 | NAM | 80.9 | 2.7e-25 | 64 | 121 | 71 | 129 |
NAM 71 gkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 g r+nrat+sgyWkatgkd+++l+ kg+lvg++ktLvfy+grapkg+kt+Wvmhe+rle orange1.1g030909m 64 GLRTNRATASGYWKATGKDRAILR-KGSLVGMRKTLVFYRGRAPKGKKTEWVMHEFRLE 121 569********************9.999****************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.35E-42 | 9 | 126 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 26.996 | 18 | 146 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.4E-23 | 19 | 120 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MSSSNNSNNN IRMVEAQLPP GFRFHPRDDE LVCDYLMKKV THTNESILLA AVDLNKCEPW 60 DIPGLRTNRA TASGYWKATG KDRAILRKGS LVGMRKTLVF YRGRAPKGKK TEWVMHEFRL 120 EGPFANSPKA SSLKIGCCVE CFTKREKFLA NRAWEAAAMT TQALHHSHH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-33 | 13 | 141 | 12 | 160 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-33 | 13 | 141 | 12 | 160 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-33 | 13 | 141 | 12 | 160 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-33 | 13 | 141 | 12 | 160 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
3swm_B | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
3swm_C | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
3swm_D | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
3swp_A | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
3swp_B | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
3swp_C | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
3swp_D | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
4dul_A | 2e-33 | 13 | 141 | 12 | 160 | NAC domain-containing protein 19 |
4dul_B | 2e-33 | 13 | 141 | 12 | 160 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006441024.1 | 1e-82 | NAC domain-containing protein 21/22 | ||||
Swissprot | Q84TE6 | 4e-59 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | A0A067EDZ5 | 1e-125 | A0A067EDZ5_CITSI; Uncharacterized protein | ||||
STRING | XP_006441024.1 | 5e-82 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3619 | 28 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56010.2 | 7e-61 | NAC domain containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g030909m |