PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g030496m | ||||||||
Common Name | CISIN_1g0264741mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 177aa MW: 19640.1 Da PI: 10.0273 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105 | 6.3e-33 | 81 | 137 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+k+ ksrkpylheSRh hAlrR+Rg+gGrF orange1.1g030496m 81 EEPVFVNAKQYHGILRRRQSRAKAESENKV-LKSRKPYLHESRHLHALRRARGCGGRF 137 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.3E-36 | 79 | 140 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.605 | 80 | 140 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 4.9E-28 | 82 | 137 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.6E-23 | 83 | 105 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 85 | 105 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.6E-23 | 114 | 137 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MGMSHPSITT PNVQYATHQV GAGHAMAPAA YPYPDPYYRS IFAPYDAQPY PPQPYGGQPM 60 VHLQLMGIQQ AGVPLPTDAV EEPVFVNAKQ YHGILRRRQS RAKAESENKV LKSRKPYLHE 120 SRHLHALRRA RGCGGRFLNS KKNENQQKGM ASDDKSQSNL NLNSDKNEIA SSDRQS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-21 | 80 | 145 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.2305 | 0.0 | callus| flower| fruit |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM472177 | 1e-53 | AM472177.2 Vitis vinifera contig VV78X243821.10, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006468306.1 | 1e-129 | nuclear transcription factor Y subunit A-7 isoform X2 | ||||
Swissprot | Q84JP1 | 6e-68 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A067GIN4 | 1e-128 | A0A067GIN4_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A067GIX8 | 1e-128 | A0A067GIX8_CITSI; Uncharacterized protein | ||||
STRING | XP_006468304.1 | 1e-129 | (Citrus sinensis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-54 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g030496m |
Publications ? help Back to Top | |||
---|---|---|---|
|