PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g030376m | ||||||||
Common Name | CISIN_1g026312mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 179aa MW: 19376.3 Da PI: 10.1611 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 149.6 | 1.1e-46 | 65 | 173 | 2 | 112 |
Whirly 2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrka 93 vyk+kaa++v++v+ptf +ldsg lk+kr+G +ll++a+a++erkydW kkq+fals+tev++l+ +++++s+effhdpa+ +sn+G++rk+ orange1.1g030376m 65 VYKGKAAFSVDPVLPTFMKLDSGDLKVKRKGVILLTFAPAIGERKYDWAKKQHFALSPTEVGSLLTMGPRDSSEFFHDPAMLSSNAGQMRKS 156 8******************************************************************************************* PP Whirly 94 lkvePlpdGsGlfvnlsvt 112 l+++ +dG +f++ls orange1.1g030376m 157 LSIKANADG--FFISLSEY 173 ****99995..89999865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 3.3E-50 | 52 | 173 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 2.98E-38 | 57 | 171 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 2.0E-45 | 65 | 172 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005739 | Cellular Component | mitochondrion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MMKLSRSLLS SRSQLSEKLL AGEANYVRDG LKSHVLISQA GMSTTGHDVS AKGSLGGRIF 60 APYYVYKGKA AFSVDPVLPT FMKLDSGDLK VKRKGVILLT FAPAIGERKY DWAKKQHFAL 120 SPTEVGSLLT MGPRDSSEFF HDPAMLSSNA GQMRKSLSIK ANADGFFISL SEYSTCVQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 3e-58 | 53 | 171 | 5 | 125 | StWhy2 |
3n1i_A | 3e-58 | 53 | 171 | 5 | 125 | protein StWhy2 |
3n1j_A | 3e-58 | 53 | 171 | 5 | 125 | Protein StWhy2 |
3n1k_A | 3e-58 | 53 | 171 | 5 | 125 | protein StWhy2 |
3n1l_A | 3e-58 | 53 | 171 | 5 | 125 | protein StWhy2 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.7069 | 0.0 | callus| flower| fruit| stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006478304.1 | 1e-121 | single-stranded DNA-binding protein WHY2, mitochondrial isoform X1 | ||||
Swissprot | D9J034 | 4e-66 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A067EBX7 | 1e-127 | A0A067EBX7_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A2H5Q793 | 1e-127 | A0A2H5Q793_CITUN; Uncharacterized protein | ||||
STRING | XP_006478304.1 | 1e-120 | (Citrus sinensis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 3e-59 | WHIRLY 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g030376m |