PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

orange1.1g027234m

Common Name

CISIN_1g027234mg

Organism

Citrus sinensis

Taxonomic ID

2711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

ARR-B

Protein Properties

Length: 227aa MW: 25495.1 Da PI: 6.884

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g027234m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	84	1.6e-26	151	204	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprl+W+ eLH++Fv+av++L G +kA Pk+ilelm+++gLt+e+v+SHLQk+Rl orange1.1g027234m 151 KPRLVWSVELHQQFVSAVKEL-GFDKAGPKKILELMNIPGLTRENVASHLQKHRL 204 79*****************.******************************8 PP
2	Response_reg	58.6	3.5e-20	2	89	22	109
TCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS Response_reg 22 gyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109 g+ +v+ + +e al++l++++ +D+++ D+ mp+mdG++ll+ e++lp+i++ ahg++e + + + +a d+l+Kp+ +eel + orange1.1g027234m 2 GF-SVTKCNRAEIALDMLRTNKngYDIVISDVHMPDMDGFKLLELVGL-EMDLPVIMMCAHGSKEVVMKGVTHDACDYLTKPVRIEELKN 89 67.899999*******988889***************87754.558*********************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00448	1.3E-5	1	91	IPR001789	Signal transduction response regulator, receiver domain
CDD	cd00156	5.25E-21	1	94	No hit	No description
PROSITE profile	PS50110	32.808	1	95	IPR001789	Signal transduction response regulator, receiver domain
SuperFamily	SSF52172	1.12E-25	1	107	IPR011006	CheY-like superfamily
PIRSF	PIRSF036392	1.8E-118	1	225	IPR017053	Response regulator B-type, plant
Gene3D	G3DSA:3.40.50.2300	2.4E-31	2	123	No hit	No description
Pfam	PF00072	5.3E-17	2	89	IPR001789	Signal transduction response regulator, receiver domain
PROSITE profile	PS51294	10.322	148	207	IPR017930	Myb domain
SuperFamily	SSF46689	4.48E-18	149	208	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.8E-28	150	209	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	5.2E-22	151	204	IPR006447	Myb domain, plants
Pfam	PF00249	4.4E-9	154	203	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 227 aa Download sequence Send to blast
MGFSVTKCNR AEIALDMLRT NKNGYDIVIS DVHMPDMDGF KLLELVGLEM DLPVIMMCAH 60 GSKEVVMKGV THDACDYLTK PVRIEELKNI WQHVVRKRKN ERKDLEQSGS VEGGAQQPKP 120 FEESDDSYSV NEGTSNSRKD EEEEAEKRLK KPRLVWSVEL HQQFVSAVKE LGFDKAGPKK 180 ILELMNIPGL TRENVASHLQ KHRLYLSRLS GVSPQQGNSF VSSNIG*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	2e-19	150	210	4	64	ARR10-B
5lxu_A	2e-19	151	206	1	56	Transcription factor LUX
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in pollen. {ECO:0000269\|PubMed:11370868, ECO:0000269\|PubMed:15173562, ECO:0000269\|PubMed:9891419}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269\|PubMed:11370868, ECO:0000269\|PubMed:11574878, ECO:0000269\|PubMed:15282545, ECO:0000269\|PubMed:16407152}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006419443.1	1e-118	two-component response regulator ARR2 isoform X1
Refseq	XP_006419445.1	1e-118	two-component response regulator ARR2 isoform X2
Refseq	XP_006419449.1	1e-119	two-component response regulator ARR2
Refseq	XP_006488883.1	1e-119	two-component response regulator ARR2-like
Refseq	XP_006488884.1	1e-119	two-component response regulator ARR2-like
Refseq	XP_024047521.1	1e-118	two-component response regulator ARR2 isoform X3
Refseq	XP_024047529.1	1e-119	two-component response regulator ARR2
Swissprot	Q9ZWJ9	8e-95	ARR2_ARATH; Two-component response regulator ARR2
TrEMBL	A0A067G8U6	1e-167	A0A067G8U6_CITSI; Uncharacterized protein
STRING	XP_006488883.1	1e-118	(Citrus sinensis)
STRING	XP_006419443.1	1e-117	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2403	27	73

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16110.1	3e-97	response regulator 2

Link Out ? help Back to Top
Phytozome	orange1.1g027234m

Publications ? help Back to Top
Takahashi N, et al. Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] Ge XM, et al. Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis. Plant J., 2015. 82(1): p. 138-50 [PMID:25704455] Takahashi N,Umeda M Cytokinins promote onset of endoreplication by controlling cell cycle machinery. Plant Signal Behav, 2014. 9(8): p. e29396 [PMID:25763620] Kobayashi K, et al. Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] Arnaud D, et al. Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis. Plant Cell, 2017. 29(3): p. 543-559 [PMID:28254779] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Takatsuka H,Higaki T,Umeda M Actin Reorganization Triggers Rapid Cell Elongation in Roots. Plant Physiol., 2018. 178(3): p. 1130-1141 [PMID:30185441]