PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g005368m
Common NameCISIN_1g005368mg, LOC102627122
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 700aa    MW: 77318 Da    PI: 6.4343
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g005368mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.98.2e-23128228198
                        EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        f+k+lt sd++++g +++ +k+a+e+       + ++ +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   +
  orange1.1g005368m 128 FCKILTASDTSTHGGFSVLRKHATEClppldmTLATP-TQELAAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--R 216
                        99**************************999744433.459************************************************..4 PP

                        SSEE..EEEEE- CS
                 B3  87 rsefelvvkvfr 98 
                         +++el+v+v+r
  orange1.1g005368m 217 GENGELRVGVRR 228
                        49999*****98 PP

2Auxin_resp102.74.8e-34254333183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        aaha++t++ F v+Y+Pr+  s+F++ ++k+++a+++ +svGmRfkm+fe+eds+err++Gt+vgv d++  +Wp+SkWrsLk
  orange1.1g005368m 254 AAHAVKTSTLFIVYYKPRT--SQFIIGLNKYLEAVHHCFSVGMRFKMRFEGEDSPERRFTGTIVGVGDFSE-QWPGSKWRSLK 333
                        79****************6..9**********************************************888.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.36E-40117257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.9E-39121243IPR015300DNA-binding pseudobarrel domain
CDDcd100178.95E-20126228No hitNo description
PROSITE profilePS5086311.899128230IPR003340B3 DNA binding domain
SMARTSM010191.7E-21128230IPR003340B3 DNA binding domain
PfamPF023627.2E-21128228IPR003340B3 DNA binding domain
PfamPF065074.1E-32254333IPR010525Auxin response factor
PfamPF023093.3E-10571672IPR033389AUX/IAA domain
SuperFamilySSF542772.55E-12578660No hitNo description
PROSITE profilePS5174525.037584665IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MAYVEPNFGC SLSSQGGPGS GDLYRELWKA CAGPLVEVPR NGERVYYFPQ GHIEQLEAST  60
NQELTHQEPL FDLPSKILCR VVHIELLAEQ ETDEVYAQIT LHPETDQTEP RSPDQCLPEP  120
PKQTVHSFCK ILTASDTSTH GGFSVLRKHA TECLPPLDMT LATPTQELAA KDLHGYEWRF  180
KHIFRGQPRR HLLTTGWSTF VTSKRLVAGD AFVFLRGENG ELRVGVRRLA HQQSSMPSSV  240
ISSQSMHLGV LATAAHAVKT STLFIVYYKP RTSQFIIGLN KYLEAVHHCF SVGMRFKMRF  300
EGEDSPERRF TGTIVGVGDF SEQWPGSKWR SLKIQWDEPA TVQRPERVSP WEIEPFVASA  360
PLNLAQPAVK SKRPRSIDIP ASEITTNSAA SAFWYQGSTQ SHDITQVVGA TEGQSSESQV  420
VRPMRQKEID STIINNSNDC SSRLAPEGIW PSSPHLNVSL NLFPDSTDDH RIVAAQSVLS  480
GYASSGRPGN TVIHEEVERG KKSEASLGCW LFGIDLKHNS NTAAPLGRKV VDPTTGTSGV  540
KGSARAASDF DASQNQDLKE VKRGMADVSR KETQNKQGSA ASTRTRTKVQ MQGIAVGRAV  600
DLTALKGYDD LFDELEKMFE IQGQLRPRDK WAVVFTDDEG DMMLAGDDQW PEFCKMVKKI  660
FIYSTEEVKN MATSSKPIAS SVEGEGTAIS LDSELKSET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-174143567355Auxin response factor 1
4ldw_A1e-174143567355Auxin response factor 1
4ldw_B1e-174143567355Auxin response factor 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006491295.10.0auxin response factor 18 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A067HEU10.0A0A067HEU1_CITSI; Auxin response factor
STRINGXP_006491295.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18