PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.349640.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 243aa MW: 27746.7 Da PI: 8.8257 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.8 | 1e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s Cucsa.349640.1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 94.3 | 2e-31 | 86 | 174 | 11 | 99 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ea + s+qqe+ kLk+++e Lqr+qR+llGedL++Ls keL++Le+qL+ slk+iRs++++++l+q+ +lq+ke+ l+e+nk+L+++l Cucsa.349640.1 86 EALELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTLKQRLV 174 4555689******************************************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.3E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.515 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.46E-46 | 2 | 76 | No hit | No description |
SuperFamily | SSF55455 | 1.01E-33 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 15.194 | 89 | 185 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 5.3E-26 | 91 | 173 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 243 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS 60 SSMLKTLERY QKCNYGAPEP NVSTREALEL SSQQEYLKLK ARYEALQRSQ RNLLGEDLGP 120 LSSKELESLE RQLDMSLKQI RSTRTQYMLD QLTDLQRKEH LLNEANKTLK QRLVEGYQVN 180 ALQLNQSADD MMYGRQQAQP PGDAFFHPLD CEPTLQIGYQ PDPITVVTAG PSMNNFLPGW 240 LP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 2e-48 | 75 | 176 | 1 | 104 | Developmental protein SEPALLATA 3 |
4ox0_B | 2e-48 | 75 | 176 | 1 | 104 | Developmental protein SEPALLATA 3 |
4ox0_C | 2e-48 | 75 | 176 | 1 | 104 | Developmental protein SEPALLATA 3 |
4ox0_D | 2e-48 | 75 | 176 | 1 | 104 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00605 | ChIP-seq | Transfer from AT1G24260 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC405564 | 0.0 | KC405564.1 Cucumis melo sepallata 3-like MADS-box protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004140534.1 | 1e-179 | PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform X1 | ||||
Swissprot | Q8LLR0 | 1e-164 | MADS4_VITVI; Agamous-like MADS-box protein MADS4 | ||||
TrEMBL | V9PDT1 | 1e-177 | V9PDT1_CUCME; MADS-box protein 5 | ||||
STRING | XP_004140534.1 | 1e-179 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF229 | 32 | 178 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G24260.1 | 1e-128 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.349640.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|