PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.307250.1 | ||||||||
Common Name | Csa_3G736740, LOC101210992 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 204aa MW: 23082.2 Da PI: 8.2214 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.5 | 1.7e-14 | 24 | 68 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT+eE++++++a +++ + Wk+I +g +t q++s+ qky Cucsa.307250.1 24 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 68 789*****************77.*********.*************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 6.28E-18 | 18 | 74 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.291 | 19 | 73 | IPR017930 | Myb domain |
TIGRFAMs | TIGR01557 | 4.7E-19 | 22 | 71 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.4E-7 | 22 | 74 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-11 | 23 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-12 | 24 | 68 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.90E-10 | 26 | 69 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0032922 | Biological Process | circadian regulation of gene expression | ||||
GO:0043966 | Biological Process | histone H3 acetylation | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0048573 | Biological Process | photoperiodism, flowering | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MTSSTAADSS GKKVRKPYTI TKSRESWTEE EHDKFLEALQ LFDRDWKKIE DFVGSKTVIQ 60 IRSHAQKYFL KVQKNGTIAH VPPPRPKRKA SHPYPQKASK NVLLPLQASM GYPSSVNTLA 120 PGYSPWDDAS IMINPSLSKI MQPQDEFTNF HRSESIPDFA EVYGFIGSIF DPDSKEHVNK 180 LKEMDPINFE TVSLRICDCA FDL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00338 | DAP | Transfer from AT3G09600 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681841 | 4e-78 | LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011. | |||
GenBank | LN713258 | 4e-78 | LN713258.1 Cucumis melo genomic chromosome, chr_4. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004137958.1 | 1e-136 | PREDICTED: protein REVEILLE 8-like isoform X2 | ||||
Swissprot | Q8RWU3 | 4e-95 | RVE8_ARATH; Protein REVEILLE 8 | ||||
TrEMBL | A0A0A0LFP1 | 1e-134 | A0A0A0LFP1_CUCSA; Uncharacterized protein | ||||
STRING | XP_004166585.1 | 1e-135 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6735 | 34 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09600.1 | 2e-97 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.307250.1 |
Entrez Gene | 101210992 |