PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.307040.2

Common Name

Csa_3G736950, LOC101214947

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

S1Fa-like

Protein Properties

Length: 79aa MW: 8464.2 Da PI: 10.8588

Description

S1Fa-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.307040.2	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	S1FA	133.8	4.3e-42	12	78	4	70
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + +eakG+nP livll+vgglll+flvgny+ly yaqknlPP+kkkPvskkk+kre+lkqGv++PGe Cucsa.307040.2 12 NDIEAKGFNPALIVLLLVGGLLLIFLVGNYALYLYAQKNLPPKKKKPVSKKKMKRERLKQGVSAPGE 78 789***************************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD019013	1.0E-4	11	78	No hit	No description
Pfam	PF04689	1.6E-39	14	78	IPR006779	DNA binding protein S1FA

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 79 aa Download sequence Send to blast
MASANGKGNV INDIEAKGFN PALIVLLLVG GLLLIFLVGN YALYLYAQKN LPPKKKKPVS 60 KKKMKRERLK QGVSAPGE*

Functional Description ? help Back to Top
Source	Description
UniProt	DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681841	1e-109	LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBank	LN713258	1e-109	LN713258.1 Cucumis melo genomic chromosome, chr_4.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004137812.1	8e-48	PREDICTED: DNA-binding protein S1FA-like
Swissprot	Q42337	6e-15	S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBL	A0A0A0LAW3	2e-46	A0A0A0LAW3_CUCSA; DNA-binding protein S1FA
STRING	XP_004165146.1	3e-47	(Cucumis sativus)

Link Out ? help Back to Top
Phytozome	Cucsa.307040.2
Entrez Gene	101214947

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402]