PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.307040.2 | ||||||||
Common Name | Csa_3G736950, LOC101214947 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 79aa MW: 8464.2 Da PI: 10.8588 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 133.8 | 4.3e-42 | 12 | 78 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + +eakG+nP livll+vgglll+flvgny+ly yaqknlPP+kkkPvskkk+kre+lkqGv++PGe Cucsa.307040.2 12 NDIEAKGFNPALIVLLLVGGLLLIFLVGNYALYLYAQKNLPPKKKKPVSKKKMKRERLKQGVSAPGE 78 789***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 1.0E-4 | 11 | 78 | No hit | No description |
Pfam | PF04689 | 1.6E-39 | 14 | 78 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 79 aa Download sequence Send to blast |
MASANGKGNV INDIEAKGFN PALIVLLLVG GLLLIFLVGN YALYLYAQKN LPPKKKKPVS 60 KKKMKRERLK QGVSAPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681841 | 1e-109 | LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011. | |||
GenBank | LN713258 | 1e-109 | LN713258.1 Cucumis melo genomic chromosome, chr_4. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004137812.1 | 8e-48 | PREDICTED: DNA-binding protein S1FA-like | ||||
Swissprot | Q42337 | 6e-15 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A0A0LAW3 | 2e-46 | A0A0A0LAW3_CUCSA; DNA-binding protein S1FA | ||||
STRING | XP_004165146.1 | 3e-47 | (Cucumis sativus) |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.307040.2 |
Entrez Gene | 101214947 |
Publications ? help Back to Top | |||
---|---|---|---|
|