PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.299710.1 | ||||||||
Common Name | Csa_4G646380 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 92aa MW: 10536.4 Da PI: 11.0076 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 72.8 | 4.3e-23 | 1 | 47 | 5 | 51 |
RWP-RK 5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 ++++dl++y +lpi +AAk++++clTv+K+iCR+ G++RWP+Rk+ks Cucsa.299710.1 1 MTVNDLKEYLHLPISEAAKKMNLCLTVVKKICRRSGLRRWPYRKVKS 47 5789******************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02042 | 1.6E-20 | 1 | 47 | IPR003035 | RWP-RK domain |
PROSITE profile | PS51519 | 16.95 | 1 | 68 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MTVNDLKEYL HLPISEAAKK MNLCLTVVKK ICRRSGLRRW PYRKVKSYQR KMGALGTRLR 60 SRDAGTRARA EAEMERLRQE LAQFCAGIVP D* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681861 | 2e-63 | LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029. | |||
GenBank | LN713261 | 2e-63 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004141337.2 | 5e-59 | PREDICTED: uncharacterized protein LOC101213670 | ||||
TrEMBL | A0A0A0L2U8 | 2e-59 | A0A0A0L2U8_CUCSA; Uncharacterized protein | ||||
STRING | XP_004141337.1 | 3e-61 | (Cucumis sativus) | ||||
STRING | XP_004157374.1 | 3e-61 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7478 | 28 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66990.1 | 2e-11 | RWP-RK domain-containing protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.299710.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|