PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.281950.1

Common Name

Csa_1G433050, LOC101203427

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

HD-ZIP

Protein Properties

Length: 265aa MW: 30632.2 Da PI: 7.2519

Description

HD-ZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.281950.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	56.9	3.6e-18	136	190	2	56
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ +++keq + Lee F+ + +++ ++++ LA++l+L++rqV vWFqNrRa+ k Cucsa.281950.1 136 RKKLRLSKEQSTLLEESFKLHTTLNPAQKQALAQQLNLKTRQVEVWFQNRRARTK 190 788899***********************************************98 PP
2	HD-ZIP_I/II	118.2	4.5e-38	136	224	1	90
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 +kk+rlskeq++lLEesF+ +++L+p +K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eLr + Cucsa.281950.1 136 RKKLRLSKEQSTLLEESFKLHTTLNPAQKQALAQQLNLKTRQVEVWFQNRRARTKLKQTEVDCEFLKKCCERLNEENRRLKKELNELR-S 224 69*************************************************************************************9.4 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	5.56E-18	119	193	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.3E-16	125	190	IPR009057	Homeodomain-like
PROSITE profile	PS50071	17.2	132	192	IPR001356	Homeobox domain
SMART	SM00389	3.8E-15	134	196	IPR001356	Homeobox domain
CDD	cd00086	7.66E-15	136	193	No hit	No description
Pfam	PF00046	1.7E-15	136	190	IPR001356	Homeobox domain
PROSITE pattern	PS00027	0	167	190	IPR017970	Homeobox, conserved site
SMART	SM00340	8.6E-19	192	235	IPR003106	Leucine zipper, homeobox-associated
Pfam	PF02183	8.3E-9	192	225	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 265 aa Download sequence Send to blast
MEDHHEDEIC NISWLSLGLG FGDQYVPKKI QKNQQQQQQL SFTLIPKEEL EITNNNNMEI 60 DDDEANSSEE DDDHHLMKRI RSSNNIVNYD HHRQDSSFGS IRRLSSDHYI NNSDIVNTTN 120 HNYKGISSSG SELRERKKLR LSKEQSTLLE ESFKLHTTLN PAQKQALAQQ LNLKTRQVEV 180 WFQNRRARTK LKQTEVDCEF LKKCCERLNE ENRRLKKELN ELRSLKLGAS QLYIQLPKAA 240 TLTICPSCDK ITRTPAVDAN SPPQ*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	133	139	RERKKLR
2	184	192	RRARTKLKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269\|PubMed:10477292, ECO:0000269\|PubMed:11260495, ECO:0000269\|PubMed:8449400}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269\|PubMed:8106086}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681813	0.0	LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBank	LN713256	0.0	LN713256.1 Cucumis melo genomic chromosome, chr_2.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004150745.1	0.0	PREDICTED: homeobox-leucine zipper protein HOX18-like
Swissprot	Q05466	3e-54	HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBL	A0A0A0M012	0.0	A0A0A0M012_CUCSA; Uncharacterized protein
STRING	XP_004150745.1	0.0	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1144	33	107

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16780.1	5e-45	homeobox protein 2

Link Out ? help Back to Top
Phytozome	Cucsa.281950.1
Entrez Gene	101203427

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development. Plant Signal Behav, 2014. [PMID:23838958] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Francisco M, et al. Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense. Front Plant Sci, 2016. 7: p. 1010 [PMID:27462337] Müller-Moulé P, et al. YUCCA auxin biosynthetic genes are required for Arabidopsis shade avoidance. PeerJ, 2016. 4: p. e2574 [PMID:27761349] Ivarson E, et al. Effects of Overexpression of WRI1 and Hemoglobin Genes on the Seed Oil Content of Lepidium campestre. Front Plant Sci, 2016. 7: p. 2032 [PMID:28119714] Kasulin L, et al. A single haplotype hyposensitive to light and requiring strong vernalization dominates Arabidopsis thaliana populations in Patagonia, Argentina. Mol. Ecol., 2017. 26(13): p. 3389-3404 [PMID:28316114] Singh M,Gupta A,Singh D,Khurana JP,Laxmi A Arabidopsis RSS1 Mediates Cross-Talk Between Glucose and Light Signaling During Hypocotyl Elongation Growth. Sci Rep, 2017. 7(1): p. 16101 [PMID:29170398]