PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.251140.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 176aa MW: 20661 Da PI: 10.0664 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.6 | 4.4e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdae+aviifs++g+lye++s Cucsa.251140.2 9 KRIENATSRQVTFSKRRNGVLKKAYELSVLCDAEIAVIIFSQKGRLYEFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 64.1 | 5.3e-22 | 80 | 172 | 6 | 98 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +++ + + ++l+ e++ ++k++e ++ ++R+llG +L+++sl eL+ L qL++sl +iR++K +l+ eqi++lq+kek l een+ L+ k+ Cucsa.251140.2 80 DTKFDRQLLQQLRLEVESINKQMELMRLSHRKLLGYGLDNCSLDELEVLDAQLQRSLFQIRARKAQLYNEQIQQLQEKEKLLLEENRILSLKV 172 444667778999*****************************************************************************9887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 8.8E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.212 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.4E-32 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.12E-42 | 3 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.859 | 88 | 175 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 5.9E-20 | 89 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MVRGKVEMKR IENATSRQVT FSKRRNGVLK KAYELSVLCD AEIAVIIFSQ KGRLYEFASS 60 EMPKIMDRYR KCTKDAKNND TKFDRQLLQQ LRLEVESINK QMELMRLSHR KLLGYGLDNC 120 SLDELEVLDA QLQRSLFQIR ARKAQLYNEQ IQQLQEKEKL LLEENRILSL KVNTF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 4e-20 | 1 | 92 | 1 | 89 | MEF2 CHIMERA |
6byy_B | 4e-20 | 1 | 92 | 1 | 89 | MEF2 CHIMERA |
6byy_C | 4e-20 | 1 | 92 | 1 | 89 | MEF2 CHIMERA |
6byy_D | 4e-20 | 1 | 92 | 1 | 89 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681848 | 3e-85 | LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006. | |||
GenBank | LN713260 | 3e-85 | LN713260.1 Cucumis melo genomic chromosome, chr_6. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004150307.1 | 1e-120 | PREDICTED: agamous-like MADS-box protein AGL19 isoform X1 | ||||
Swissprot | Q9FIS1 | 1e-66 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A1S3AYR2 | 1e-107 | A0A1S3AYR2_CUCME; MADS-box protein AGL42-like isoform X1 | ||||
STRING | XP_004169301.1 | 1e-120 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 2e-58 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.251140.2 |