PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.197680.1

Common Name

Csa_1G009710, LOC101221523

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

ZF-HD

Protein Properties

Length: 85aa MW: 9477.55 Da PI: 8.5154

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.197680.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	103.1	1.8e-32	27	84	2	60
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++vrY eC+kNhAa+lGg avDGC+Efm+ ge+gt +al+CaACgCHRnFHRrev+ e Cucsa.197680.1 27 SEVRYAECQKNHAAKLGGFAVDGCREFMAR-GEDGTEEALNCAACGCHRNFHRREVDAE 84 579************************8.999*******************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	5.0E-22	27	85	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	8.9E-30	29	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	6.0E-27	30	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.362	31	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MKKRLVVVRK SDGSNGRRNH HWSSSGSEVR YAECQKNHAA KLGGFAVDGC REFMARGEDG 60 TEEALNCAAC GCHRNFHRRE VDAEV

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:16412086, ECO:0000269\|PubMed:21059647, ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681813	1e-127	LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBank	LN713256	1e-127	LN713256.1 Cucumis melo genomic chromosome, chr_2.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004138166.1	9e-57	PREDICTED: mini zinc finger protein 3-like
Swissprot	Q9CA51	1e-28	MIF1_ARATH; Mini zinc finger protein 1
TrEMBL	A0A0A0LSA6	2e-55	A0A0A0LSA6_CUCSA; Uncharacterized protein
STRING	XP_004138166.1	4e-56	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1550	34	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74660.1	4e-31	mini zinc finger 1

Link Out ? help Back to Top
Phytozome	Cucsa.197680.1
Entrez Gene	101221523

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402]