PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.158180.1

Common Name

Csa_5G637160

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

NAC

Protein Properties

Length: 326aa MW: 36591.1 Da PI: 7.9954

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.158180.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	177.3	4.1e-55	27	152	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeel+++yL +kv + +++ +i ++d++k+ePwdLp ++k +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkdke+++ Cucsa.158180.1 27 LPPGFRFHPTDEELITHYLSPKVLNPNFSS-IAIGHADLNKSEPWDLPGRAKMGEKEWYFFCVKDRKYPTGLRTNRATESGYWKATGKDKEIFR- 119 79***********************999.78***********99999*************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++lvg+kktLvfykgrapkgek++Wvmhe+rl Cucsa.158180.1 120 GKKLVGMKKTLVFYKGRAPKGEKSNWVMHEFRL 152 99***************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.75E-63	19	174	IPR003441	NAC domain
PROSITE profile	PS51005	58.864	27	174	IPR003441	NAC domain
Pfam	PF02365	3.1E-29	28	152	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 326 aa Download sequence Send to blast
MAETQTQTQT NNFWNHTNNE EHQQIDLPPG FRFHPTDEEL ITHYLSPKVL NPNFSSIAIG 60 HADLNKSEPW DLPGRAKMGE KEWYFFCVKD RKYPTGLRTN RATESGYWKA TGKDKEIFRG 120 KKLVGMKKTL VFYKGRAPKG EKSNWVMHEF RLQPKFIIKP TTKNEWVICR IFNKSSTESK 180 SLPSIIMNNN PFNSPALPAL MEYSQSQTPY TGEARAASHV SCFSNDGGGG GGDTKLYNFR 240 TNYNHHFSSS SSSSAPPPAP PLLPFPLPNT ADSGYGNSIM RMLMNPKVEI SGYSSNGIGM 300 MEGDDDQNPS LVSDDPLDLE CLWNY*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-54	24	180	14	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-54	24	180	14	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-54	24	180	14	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-54	24	180	14	171	NO APICAL MERISTEM PROTEIN
3swm_A	2e-54	24	180	17	174	NAC domain-containing protein 19
3swm_B	2e-54	24	180	17	174	NAC domain-containing protein 19
3swm_C	2e-54	24	180	17	174	NAC domain-containing protein 19
3swm_D	2e-54	24	180	17	174	NAC domain-containing protein 19
3swp_A	2e-54	24	180	17	174	NAC domain-containing protein 19
3swp_B	2e-54	24	180	17	174	NAC domain-containing protein 19
3swp_C	2e-54	24	180	17	174	NAC domain-containing protein 19
3swp_D	2e-54	24	180	17	174	NAC domain-containing protein 19
4dul_A	1e-54	24	180	14	171	NAC domain-containing protein 19
4dul_B	1e-54	24	180	14	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269\|PubMed:15295076, ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:21303842, ECO:0000269\|PubMed:23340744, ECO:0000269\|PubMed:23459204, ECO:0000269\|PubMed:9351240}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19608714, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:20404534, ECO:0000269\|PubMed:21511905, ECO:0000269\|PubMed:22930749}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681889	0.0	LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBank	LN713263	0.0	LN713263.1 Cucumis melo genomic chromosome, chr_9.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008459335.1	0.0	PREDICTED: NAC domain-containing protein 92-like isoform X2
Swissprot	Q9FKA0	3e-96	NAC92_ARATH; NAC domain-containing protein 92
TrEMBL	A0A0A0KSA1	0.0	A0A0A0KSA1_CUCSA; Uncharacterized protein
STRING	XP_004171621.1	0.0	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF24620	3	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G39610.1	2e-97	NAC domain containing protein 6

Link Out ? help Back to Top
Phytozome	Cucsa.158180.1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Khan M,Rozhon W,Poppenberger B The role of hormones in the aging of plants - a mini-review. Gerontology, 2014. 60(1): p. 49-55 [PMID:24135638] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast. Plant J., 2015. 81(3): p. 377-87 [PMID:25440717] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Kim H, et al. Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453 [PMID:30065116]