PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.149510.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 117aa MW: 13217 Da PI: 9.2799 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 41.7 | 3.9e-13 | 16 | 50 | 1 | 36 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36 +ep++ Na Qy++Il+RR +Rak+e+e+k ksrk Cucsa.149510.1 16 EEPVFFNAEQYHGILRRRLSRAKAESENKA-LKSRK 50 69***************************9.78887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.0E-11 | 14 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 17.672 | 15 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.6E-8 | 17 | 51 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MGIQQAGVPL LTDAVEEPVF FNAEQYHGIL RRRLSRAKAE SENKALKSRK FITSHCIYLL 60 VLIQWGARGC GGRFLKSNEN ENHQNEVASG FGSMLLREDP KCSRQKYASF NTIVNTE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681875 | 5e-61 | LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007. | |||
GenBank | LN713262 | 5e-61 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004134622.1 | 9e-41 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Refseq | XP_011658320.1 | 9e-41 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Refseq | XP_011658321.1 | 9e-41 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q84JP1 | 5e-27 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A0A0KIV0 | 2e-39 | A0A0A0KIV0_CUCSA; Uncharacterized protein | ||||
STRING | XP_004134622.1 | 3e-40 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5379 | 33 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.1 | 2e-29 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.149510.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|