PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.126800.1 | ||||||||
Common Name | Csa_1G074960, LOC105435194 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 154aa MW: 16421.9 Da PI: 9.8375 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 125.7 | 1.5e-39 | 17 | 75 | 4 | 62 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 +++kcprCds+ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvP+Ggg+rk+k+ + Cucsa.126800.1 17 QKQKCPRCDSSNTKFCYYNNYSLSQPRYFCKSCRRYWTHGGTLRNVPIGGGSRKSKRPK 75 6789***************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 5.0E-25 | 7 | 73 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.2E-34 | 17 | 73 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.05 | 19 | 73 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 21 | 57 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MQGAPNEDQT KASTIIQKQK CPRCDSSNTK FCYYNNYSLS QPRYFCKSCR RYWTHGGTLR 60 NVPIGGGSRK SKRPKSTLLP SSSSSSDTTT TLTPPPPGGS GPLDLATSSY NSSAAFLSSL 120 DVGAAYSSFG GLAWTTATPI NNTIITNNHS SSSX |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681932 | 0.0 | LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001. | |||
GenBank | LN713266 | 0.0 | LN713266.1 Cucumis melo genomic chromosome, chr_12. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011653263.1 | 1e-108 | PREDICTED: dof zinc finger protein DOF2.2-like | ||||
Swissprot | Q9SVC5 | 1e-33 | DOF35_ARATH; Dof zinc finger protein DOF3.5 | ||||
TrEMBL | A0A0A0LXF4 | 1e-106 | A0A0A0LXF4_CUCSA; Uncharacterized protein | ||||
STRING | XP_008442727.1 | 1e-77 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4145 | 32 | 58 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60200.1 | 1e-31 | TARGET OF MONOPTEROS 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.126800.1 |
Entrez Gene | 105435194 |
Publications ? help Back to Top | |||
---|---|---|---|
|