PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.111120.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 220aa MW: 24773.6 Da PI: 10.0417 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.5 | 4.2e-15 | 35 | 82 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+ +Ed ll++ + +G g+W++ a + g++Rt+k+c++rw++yl Cucsa.111120.1 35 RGPWSVDEDSLLIHSISVHGEGRWNLLAIRSGLRRTGKSCRLRWLNYL 82 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.6 | 9.3e-16 | 88 | 131 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ +++E++l++d++ ++G++ W++Ia+ ++ gRt++++k++w++ Cucsa.111120.1 88 RGNLSPQEQLLILDLHSRWGNR-WSKIAQQLP-GRTDNEIKNYWRT 131 7899******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.356 | 30 | 82 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-13 | 34 | 84 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.06E-28 | 34 | 129 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-13 | 35 | 82 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-19 | 36 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.02E-9 | 37 | 82 | No hit | No description |
PROSITE profile | PS51294 | 22.873 | 83 | 137 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-13 | 87 | 135 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-14 | 88 | 131 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.5E-22 | 90 | 136 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.56E-9 | 92 | 131 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MASPCKNPSP SPSPSPSSSG SYSFIEDDQS EAVRRGPWSV DEDSLLIHSI SVHGEGRWNL 60 LAIRSGLRRT GKSCRLRWLN YLKPEVKRGN LSPQEQLLIL DLHSRWGNRW SKIAQQLPGR 120 TDNEIKNYWR TKVQKQAKIL NISTNSPEFK DIINRFWIPR LLHQINDSSS SSSSPPPPPH 180 TAATHPTPQF SDSDSLPAAD GKRRHFEQNS TSSESVEISQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-23 | 35 | 137 | 7 | 108 | B-MYB |
1mse_C | 1e-23 | 35 | 137 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-23 | 35 | 137 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681813 | 1e-115 | LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030. | |||
GenBank | LN713256 | 1e-115 | LN713256.1 Cucumis melo genomic chromosome, chr_2. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004137543.1 | 1e-158 | PREDICTED: myb-related protein 305-like | ||||
Swissprot | Q9C9G7 | 8e-70 | MYB62_ARATH; Transcription factor MYB62 | ||||
TrEMBL | A0A1S3BWZ6 | 1e-129 | A0A1S3BWZ6_CUCME; transcription factor MYB24-like | ||||
STRING | XP_004137543.1 | 1e-157 | (Cucumis sativus) | ||||
STRING | XP_004167332.1 | 1e-157 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1639 | 34 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G25340.1 | 8e-70 | myb domain protein 116 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.111120.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|