PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.107740.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 217aa MW: 24805.9 Da PI: 8.2196 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.3 | 4.1e-14 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l + + G g+W++++ + g+ R k+c++rw++yl Cucsa.107740.2 14 KGLWSPEEDEKLRSFILKNGHGCWTSVPIKAGLLRNSKSCRLRWFNYL 61 678*****************************99************97 PP | |||||||
2 | Myb_DNA-binding | 51.7 | 2e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++++Ede+++ ++++lG++ W+ Ia+++ gRt++++k++w+++l Cucsa.107740.2 67 RGMFSQQEDEKILTLHRLLGNR-WSQIAQHLA-GRTDNEIKNYWNSHL 112 788*******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.866 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.53E-27 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.9E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.2E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-19 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.19E-8 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.738 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.1E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-26 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.13E-11 | 70 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MGCRETEKEK VKKKGLWSPE EDEKLRSFIL KNGHGCWTSV PIKAGLLRNS KSCRLRWFNY 60 LRPGLKRGMF SQQEDEKILT LHRLLGNRWS QIAQHLAGRT DNEIKNYWNS HLKKKVVLNF 120 QDLKSGVFSN RDPPLEEMGS SGNERIESQP RVLFAEWLSV SDVNGGSSME GSFDGEGRRT 180 SREGYGFEML NWDLDFEGHI SDGFATCDQL CREQTG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-24 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681848 | 1e-93 | LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006. | |||
GenBank | LN713260 | 1e-93 | LN713260.1 Cucumis melo genomic chromosome, chr_6. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011652772.1 | 1e-147 | PREDICTED: LOW QUALITY PROTEIN: transcription factor LAF1-like | ||||
Swissprot | Q9M0K4 | 7e-54 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | A0A0A0L6I1 | 1e-136 | A0A0A0L6I1_CUCSA; Uncharacterized protein | ||||
STRING | XP_008439216.1 | 1e-123 | (Cucumis melo) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G25560.1 | 3e-56 | myb domain protein 18 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.107740.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|