PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.104010.6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 205aa MW: 23825.4 Da PI: 10.6097 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.5 | 1.7e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i+n + rqvtfskRr g++KKA+ELSvLCda+va+iifs tgkl+eyss Cucsa.104010.6 10 KIDNATARQVTFSKRRRGLFKKAKELSVLCDADVALIIFSATGKLFEYSS 59 69**********************************************96 PP | |||||||
2 | K-box | 54.6 | 4.7e-19 | 92 | 170 | 19 | 97 |
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 ++++L+kei + +++R++ Ge+L++L+++eLqqLe+ Le++l+++ +kK e ++++i +lq+k el +enk+L+++ Cucsa.104010.6 92 SNYTRLNKEIAEKTHQLRQMRGEELQTLNIEELQQLEKSLESGLSRVMEKKGERIMKEITDLQRKSAELMDENKRLKQQ 170 6799************************************************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.829 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.0E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.88E-39 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 5.23E-31 | 3 | 85 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.051 | 87 | 180 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.5E-16 | 92 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 205 aa Download sequence Send to blast |
MAKEKIQIRK IDNATARQVT FSKRRRGLFK KAKELSVLCD ADVALIIFSA TGKLFEYSSS 60 SMKGIIERHN LHSKNLQKLE QPSLELQLVE NSNYTRLNKE IAEKTHQLRQ MRGEELQTLN 120 IEELQQLEKS LESGLSRVME KKGERIMKEI TDLQRKSAEL MDENKRLKQQ TWRFAGGENE 180 WRKAPGRRAR DFGRGGWPVV EFRH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681875 | 1e-84 | LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007. | |||
GenBank | LN713262 | 1e-84 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004143442.1 | 1e-118 | PREDICTED: MADS-box protein SVP-like isoform X1 | ||||
Refseq | XP_008440538.1 | 1e-118 | PREDICTED: MADS-box protein SVP-like | ||||
Refseq | XP_008440540.1 | 1e-118 | PREDICTED: MADS-box protein SVP-like | ||||
Refseq | XP_011657947.1 | 1e-118 | PREDICTED: MADS-box protein SVP-like isoform X1 | ||||
Swissprot | Q9FUY6 | 6e-94 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A1S3B1C2 | 1e-116 | A0A1S3B1C2_CUCME; MADS-box protein SVP-like | ||||
STRING | XP_008440538.1 | 1e-117 | (Cucumis melo) | ||||
STRING | XP_004143442.1 | 1e-117 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-84 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.104010.6 |
Publications ? help Back to Top | |||
---|---|---|---|
|