PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.095090.1 | ||||||||
Common Name | Csa_4G012390, LOC101219926 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 216aa MW: 24596.3 Da PI: 9.5091 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102.1 | 3.2e-32 | 135 | 193 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+ Cucsa.095090.1 135 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCKVKKQVQRLTRDEGVVVTTYEGIHSHP 193 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.6E-33 | 120 | 193 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.62E-29 | 127 | 194 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.815 | 130 | 195 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.5E-38 | 135 | 194 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.9E-26 | 136 | 193 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0010055 | Biological Process | atrichoblast differentiation | ||||
GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MMENFPSFLS TSSSSSALSL QQILFSRASN HGGDHFRQPP FVSDGFPILF RDVSTDDMSF 60 DATSSVKDDD RNNVAVSVST ERFRVDGSSG RSGVVEYGLK KEEGEGRGRG EDCDKKKKMR 120 NRRFAFQTRS QVDILDDGYR WRKYGQKAVK NNKFPRSYYR CTHQGCKVKK QVQRLTRDEG 180 VVVTTYEGIH SHPIEKSTDN FEHILSQMQI YTTSY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-27 | 125 | 192 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-27 | 125 | 192 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00506 | DAP | Transfer from AT5G13080 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681874 | 5e-78 | LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031. | |||
GenBank | LN713261 | 5e-78 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004152302.2 | 1e-160 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 2e-55 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A0A0KU50 | 1e-159 | A0A0A0KU50_CUCSA; Uncharacterized protein | ||||
STRING | XP_008454014.1 | 1e-111 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 2e-57 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.095090.1 |
Entrez Gene | 101219926 |