PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.058070.1
Common NameCsa_4G622780, LOC101219900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family STAT
Protein Properties Length: 711aa    MW: 79518.4 Da    PI: 5.4213
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.058070.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT1994.4e-622233431121
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldv+ll++ gqpv k++evvasL+yadsg++veks+d+eapLL+sydGvef+s+drp+kll+GrasfklkisqLsskcdn+Lfri+f+ip++++y
  Cucsa.058070.1 223 LDVMLLDSSGQPVLKELEVVASLIYADSGEAVEKSGDEEAPLLASYDGVEFASSDRPSKLLHGRASFKLKISQLSSKCDNKLFRIRFCIPRVEAY 317
                     8********************************************************************************************** PP

            STAT  96 pfleavskpirCisrsrntrsssltk 121
                     pf+ea+s+pirCisrsrntr+s+l+ 
  Cucsa.058070.1 318 PFFEALSSPIRCISRSRNTRMSTLML 343
                     ********************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498991.08E-821170IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:2.60.120.2001.3E-527156IPR013320Concanavalin A-like lectin/glucanase domain
CDDcd103383.72E-55601710No hitNo description
Gene3DG3DSA:3.30.505.103.4E-7605695IPR000980SH2 domain
SuperFamilySSF555504.68E-8609674IPR000980SH2 domain
PROSITE profilePS5000110.938612694IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MGSEVNESDE YSLLKNLRLE FDGDDGCFTV CFWVYLMNST TFPVSILQQV QLDSSSMTPF  60
LILSEWNRLK IMPLTTLHKA DEGSSPGSSS SANVVPHEYL DVDFPMEKWV HIGCEVSTDF  120
VRLHIDGKMV GEKPVSSSLS EDTFPRALGT IVLGNNGEDI SLQGYIHNEK VLPSASLIRD  180
HYAEDLPVKL FIDNSSTMEI EEGGDGIWNI VGGKPSCRRN FSLDVMLLDS SGQPVLKELE  240
VVASLIYADS GEAVEKSGDE EAPLLASYDG VEFASSDRPS KLLHGRASFK LKISQLSSKC  300
DNKLFRIRFC IPRVEAYPFF EALSSPIRCI SRSRNTRMST LMLKRSTFHP LDVSRSSGLD  360
NGTSEHEHVS VEEEKPSPLL KRVKLGQDRP TPIDDPSSGQ PDEECNSHSF TANGAGNGFG  420
SRTERSKNNG STGASPSDSG STEARHSVLN RTRTNGNPIS DVNIFKYCLG GLSERSLLLK  480
EIATSVSQEE ILEFAEHVSL YSGCLHHRHQ ILMSRKLIEE GTRAWNSISQ NKHHVHWENV  540
VFEIEEQFMR ISGCSSRSLT QQDFELLRRI SGCQEYLAQE NFERMWCWLY PVAFTLSRQW  600
INAMWSSLSP KWIEGFITKE EAELSLQSPA GLQDPGTFIL RFPTSRSWPH PDAGSLVVTY  660
VGNDYALHHR LLTLDRIFSS TEGEKNMRSL QDMLLAEPEL SRLGRTIRSH *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004146076.20.0PREDICTED: uncharacterized protein LOC101219900
SwissprotQ56XZ10.0SHB_ARATH; SH2 domain-containing protein B
TrEMBLA0A0A0L1Y60.0A0A0A0L1Y6_CUCSA; Uncharacterized protein
STRINGXP_004162113.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]
  2. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  3. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]