PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.048980.1 | ||||||||
Common Name | Csa_6G538700, LOC105436048 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 148aa MW: 16977.7 Da PI: 10.4809 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.3 | 1.7e-13 | 6 | 59 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+lv++ k+ + +W++++++ g+ R++k+c++rw +yl Cucsa.048980.1 6 RGLWSPEEDEKLVKCMKRILSSdgaqaaCWSRVPKMAGLERCGKSCRLRWINYL 59 788**************998888*****************************97 PP | |||||||
2 | Myb_DNA-binding | 53.1 | 7.4e-17 | 65 | 107 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg +++eE+ ++d+++ lG++ W+ Ia++++ gRt++++k++w+ Cucsa.048980.1 65 RGCFSAEEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEIKNFWN 107 899*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.866 | 1 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.73E-25 | 4 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.4E-8 | 5 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.4E-12 | 6 | 59 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-19 | 7 | 66 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.51E-5 | 9 | 59 | No hit | No description |
PROSITE profile | PS51294 | 25.375 | 60 | 114 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-15 | 64 | 112 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-15 | 65 | 108 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-25 | 67 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.14E-11 | 68 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MKKVKRGLWS PEEDEKLVKC MKRILSSDGA QAACWSRVPK MAGLERCGKS CRLRWINYLR 60 PDLKRGCFSA EEERTIIDVH RILGNRWAQI AKHLPGRTDN EIKNFWNSSI KKKLIAQGLD 120 PTTHNLLPAS TTNTIYNHHQ SIIISQSP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-29 | 6 | 114 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681875 | 1e-154 | LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007. | |||
GenBank | LN713262 | 1e-154 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011658528.1 | 1e-108 | PREDICTED: transcription repressor MYB6-like | ||||
Swissprot | P20027 | 2e-56 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | A0A0A0KPD6 | 1e-107 | A0A0A0KPD6_CUCSA; Uncharacterized protein | ||||
STRING | XP_008439425.1 | 1e-100 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3466 | 32 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12720.1 | 7e-68 | myb domain protein 67 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.048980.1 |
Entrez Gene | 105436048 |
Publications ? help Back to Top | |||
---|---|---|---|
|