PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.048040.1 | ||||||||
Common Name | Csa_6G525240, LOC101213331 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 149aa MW: 16717.8 Da PI: 7.2428 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 131.3 | 4.2e-41 | 15 | 115 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +Ca+Ck+lrrkC dC++apyfpa+qp+kf++vh+++Gasnv+k+lka + +ere++++slv+eAear++dPv+G+v++i lqq+l++l++ela Cucsa.048040.1 15 PCASCKFLRRKCDVDCIFAPYFPADQPQKFEVVHRIYGASNVSKILKASRYDEREETVKSLVFEAEARLEDPVHGCVAFIAGLQQRLQRLQTELA 109 7********************************************************************************************** PP DUF260 96 llkeel 101 ++++l Cucsa.048040.1 110 IVQQQL 115 ***986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.171 | 14 | 115 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.7E-39 | 15 | 113 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MSSSNSQSQK IYGSPCASCK FLRRKCDVDC IFAPYFPADQ PQKFEVVHRI YGASNVSKIL 60 KASRYDEREE TVKSLVFEAE ARLEDPVHGC VAFIAGLQQR LQRLQTELAI VQQQLLSYMA 120 SQLPPNSSYM ASELPPNSSY MASELPPNX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-40 | 13 | 123 | 9 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-40 | 13 | 123 | 9 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681875 | 1e-147 | LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007. | |||
GenBank | LN713262 | 1e-147 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004134907.2 | 1e-102 | PREDICTED: LOB domain-containing protein 4-like | ||||
Swissprot | Q9FKZ3 | 2e-40 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A0A0KIS2 | 1e-101 | A0A0A0KIS2_CUCSA; Uncharacterized protein | ||||
STRING | XP_004134907.1 | 1e-105 | (Cucumis sativus) | ||||
STRING | XP_004158683.1 | 1e-104 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1664 | 34 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 5e-38 | ASYMMETRIC LEAVES 2-like 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.048040.1 |
Entrez Gene | 101213331 |
Publications ? help Back to Top | |||
---|---|---|---|
|