PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

gw1.15.242.1

Common Name

COCSUDRAFT_9894

Organism

Coccomyxa subellipsoidea C-169

Taxonomic ID

574566

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea

Family

G2-like

Protein Properties

Length: 59aa MW: 6924.26 Da PI: 11.3794

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gw1.15.242.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	95.8	3.2e-30	2	56	1	56
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 kprl+Wt eLH+rF++av++L G ++A+Pktil+lm+v+g+t+e+v+SHLQkYRl+ gw1.15.242.1 2 KPRLVWTAELHARFMNAVTHL-GVKHAVPKTILQLMNVEGMTRENVASHLQKYRLY 56 79*****************.9*****************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.8E-30	1	59	IPR009057	Homeodomain-like
PROSITE profile	PS51294	13.713	1	58	IPR017930	Myb domain
SuperFamily	SSF46689	1.25E-20	1	59	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	6.7E-26	2	55	IPR006447	Myb domain, plants
Pfam	PF00249	5.3E-8	5	54	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0007623	Biological Process	circadian rhythm
GO:0009909	Biological Process	regulation of flower development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
KKPRLVWTAE LHARFMNAVT HLGVKHAVPK TILQLMNVEG MTRENVASHL QKYRLYLKR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5lxu_A	2e-29	2	58	1	57	Transcription factor LUX
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that is a critical component of the regulatory circuit of the circadian clock. Binds to specific sites on CCA1 promoter leading to CCA1 activation. Is required for the rhythmic expression of other clock genes such as LHY, GI and APRR1/TOC1. {ECO:0000269\|PubMed:21447790}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_005644940.1	9e-37	hypothetical protein COCSUDRAFT_9894, partial
Swissprot	Q9LTH4	2e-30	PCLL_ARATH; Transcription factor BOA
TrEMBL	I0YPS7	2e-35	I0YPS7_COCSC; Uncharacterized protein (Fragment)
STRING	XP_005644940.1	3e-36	(Coccomyxa subellipsoidea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP111	16	45

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59570.1	9e-33	G2-like family protein

Link Out ? help Back to Top
Entrez Gene	17038372

Publications ? help Back to Top
Blanc G, et al. The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation. Genome Biol., 2012. 13(5): p. R39 [PMID:22630137] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]