PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | gw1.15.242.1 | ||||||||
Common Name | COCSUDRAFT_9894 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 59aa MW: 6924.26 Da PI: 11.3794 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 95.8 | 3.2e-30 | 2 | 56 | 1 | 56 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 kprl+Wt eLH+rF++av++L G ++A+Pktil+lm+v+g+t+e+v+SHLQkYRl+ gw1.15.242.1 2 KPRLVWTAELHARFMNAVTHL-GVKHAVPKTILQLMNVEGMTRENVASHLQKYRLY 56 79*******************.9*******************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.8E-30 | 1 | 59 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 13.713 | 1 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.25E-20 | 1 | 59 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.7E-26 | 2 | 55 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 5.3E-8 | 5 | 54 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 59 aa Download sequence Send to blast |
KKPRLVWTAE LHARFMNAVT HLGVKHAVPK TILQLMNVEG MTRENVASHL QKYRLYLKR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5lxu_A | 2e-29 | 2 | 58 | 1 | 57 | Transcription factor LUX |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that is a critical component of the regulatory circuit of the circadian clock. Binds to specific sites on CCA1 promoter leading to CCA1 activation. Is required for the rhythmic expression of other clock genes such as LHY, GI and APRR1/TOC1. {ECO:0000269|PubMed:21447790}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005644940.1 | 9e-37 | hypothetical protein COCSUDRAFT_9894, partial | ||||
Swissprot | Q9LTH4 | 2e-30 | PCLL_ARATH; Transcription factor BOA | ||||
TrEMBL | I0YPS7 | 2e-35 | I0YPS7_COCSC; Uncharacterized protein (Fragment) | ||||
STRING | XP_005644940.1 | 3e-36 | (Coccomyxa subellipsoidea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP111 | 16 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59570.1 | 9e-33 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 17038372 |
Publications ? help Back to Top | |||
---|---|---|---|
|