PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | gw1.10.406.1 | ||||||||
Common Name | COCSUDRAFT_7682 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 166aa MW: 19424.1 Da PI: 10.0802 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.6 | 5.8e-18 | 13 | 57 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT+eEde l +av +G ++Wk+Ia+++ Rt+ qc +rwqk+l gw1.10.406.1 13 GWTAEEDEVLRRAVSYYGAKNWKKIAEHFE-DRTDVQCLHRWQKVL 57 6*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 66.3 | 5.6e-21 | 63 | 109 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++++++v++lG ++W++Ia+ ++ gR +kqc++rw+++l gw1.10.406.1 63 KGPWTPEEDLKIIELVTRLGAKRWSLIAKDLP-GRIGKQCRERWHNHL 109 79******************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 59.7 | 6.4e-19 | 115 | 159 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg WT+eEd lv+ ++++G+ W++Ia+ ++ gRt++ +k++w++ gw1.10.406.1 115 RGDWTKEEDSMLVEKHAEYGNQ-WAKIAQFLP-GRTDNAIKNHWNST 159 899*****************99.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.864 | 1 | 57 | IPR017930 | Myb domain |
SMART | SM00717 | 8.5E-15 | 10 | 59 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.19E-18 | 12 | 67 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 6.5E-16 | 12 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.1E-24 | 13 | 73 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.17E-13 | 14 | 57 | No hit | No description |
PROSITE profile | PS51294 | 31.475 | 58 | 113 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.1E-33 | 60 | 156 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.0E-17 | 62 | 111 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-19 | 63 | 109 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.33E-14 | 65 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.5E-29 | 74 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.7E-18 | 114 | 162 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 24.11 | 114 | 164 | IPR017930 | Myb domain |
Pfam | PF00249 | 4.1E-17 | 115 | 158 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-25 | 117 | 164 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.11E-11 | 118 | 157 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0032875 | Biological Process | regulation of DNA endoreduplication | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003713 | Molecular Function | transcription coactivator activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
KTGAPTRRSA VGGWTAEEDE VLRRAVSYYG AKNWKKIAEH FEDRTDVQCL HRWQKVLNPE 60 LVKGPWTPEE DLKIIELVTR LGAKRWSLIA KDLPGRIGKQ CRERWHNHLD PTIKRGDWTK 120 EEDSMLVEKH AEYGNQWAKI AQFLPGRTDN AIKNHWNSTM RRKVES |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 4e-72 | 12 | 164 | 9 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 4e-72 | 12 | 164 | 9 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269|PubMed:20018666}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00505 | DAP | Transfer from AT5G11510 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17287251}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005647035.1 | 1e-120 | Homeodomain-like protein, partial | ||||
Swissprot | Q6R032 | 4e-79 | MB3R5_ARATH; Transcription factor MYB3R-5 | ||||
Swissprot | Q94FL9 | 7e-77 | MB3R4_ARATH; Transcription factor MYB3R-4 | ||||
TrEMBL | I0YVS2 | 1e-119 | I0YVS2_COCSC; Homeodomain-like protein (Fragment) | ||||
STRING | XP_005647035.1 | 1e-120 | (Coccomyxa subellipsoidea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP15 | 16 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02320.2 | 2e-81 | myb domain protein 3r-5 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 17040477 |