PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | gw1.1.725.1 | ||||||||
Common Name | COCSUDRAFT_8449 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 171aa MW: 19107.2 Da PI: 10.4012 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 86 | 3.4e-27 | 2 | 59 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 dDgy+WrKYG K+vkgs++prsYY+C++++C+vkk ver+ e+++v + +g Hnh gw1.1.725.1 2 DDGYHWRKYGEKQVKGSPYPRSYYKCSQQNCQVKKIVERNPENGEVSKSASKGVHNHA 59 8********************************************************7 PP | |||||||
2 | WRKY | 99.9 | 1.5e-31 | 111 | 169 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYGqK vkg+++prsYY+Ct agC+v+k+v rsa++ v+++ Yeg+Hnh+ gw1.1.725.1 111 MDDGYRWRKYGQKIVKGNPHPRSYYKCTVAGCTVRKHVGRSATEAGVLVTSYEGQHNHP 169 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00774 | 6.0E-26 | 1 | 60 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 25.281 | 1 | 61 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.37E-23 | 2 | 61 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 2.1E-23 | 2 | 61 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.4E-21 | 2 | 58 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 9.1E-32 | 97 | 171 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-27 | 105 | 171 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 32.627 | 106 | 171 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.5E-34 | 111 | 170 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.2E-25 | 112 | 169 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0031347 | Biological Process | regulation of defense response | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
NDDGYHWRKY GEKQVKGSPY PRSYYKCSQQ NCQVKKIVER NPENGEVSKS ASKGVHNHAK 60 PGGSQGVGTS GRGGRFQGRG RAAQTSSLMR VQVQRSDNKH VVESRTDQDS MDDGYRWRKY 120 GQKIVKGNPH PRSYYKCTVA GCTVRKHVGR SATEAGVLVT SYEGQHNHPQ P |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-29 | 2 | 171 | 8 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-29 | 2 | 171 | 8 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005651953.1 | 1e-124 | WRKY-domain-containing protein, partial | ||||
Swissprot | Q93WU7 | 2e-50 | WRK58_ARATH; Probable WRKY transcription factor 58 | ||||
TrEMBL | I0Z9U0 | 1e-122 | I0Z9U0_COCSC; WRKY-domain-containing protein (Fragment) | ||||
STRING | XP_005651953.1 | 1e-123 | (Coccomyxa subellipsoidea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP469 | 16 | 26 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G07100.2 | 1e-50 | WRKY DNA-binding protein 26 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 17045424 |
Publications ? help Back to Top | |||
---|---|---|---|
|