PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | e_gw1.1.754.1 | ||||||||
Common Name | COCSUDRAFT_11556 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 117aa MW: 13246.1 Da PI: 4.6962 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 176.4 | 2.9e-55 | 15 | 107 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddl+wa++ lGfe+y eplk+yl+kyre+ e_gw1.1.754.1 15 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLVWAMGILGFEEYGEPLKLYLHKYREV 107 69*****************************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.3E-51 | 12 | 106 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.78E-38 | 18 | 107 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.9E-28 | 21 | 85 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.0E-20 | 49 | 67 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 52 | 68 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.0E-20 | 68 | 86 | No hit | No description |
PRINTS | PR00615 | 3.0E-20 | 87 | 105 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MDNDLDDGDE KGGNVREQDR FLPIANISRI MKKALPANAK IAKDAKETVQ ECVSEFISFI 60 TSEASDKCQR EKRKTINGDD LVWAMGILGF EEYGEPLKLY LHKYREVCFE ILLKDS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-46 | 15 | 106 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-46 | 15 | 106 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005651963.1 | 1e-81 | CCAAT-binding transcription factor subunit A | ||||
Swissprot | O23310 | 6e-59 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | I0Z9V0 | 3e-80 | I0Z9V0_COCSC; CCAAT-binding transcription factor subunit A | ||||
STRING | XP_005651963.1 | 6e-81 | (Coccomyxa subellipsoidea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2023 | 16 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-61 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 17045434 |
Publications ? help Back to Top | |||
---|---|---|---|
|