PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK29334.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

LBD

Protein Properties

Length: 65aa MW: 7353.12 Da PI: 5.8113

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK29334.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	88.5	8.6e-28	2	65	15	78
DUF260 15 dCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavg 78 C++apyf +++pkkfa vhk+FGasnv+k+l ++pee+red+++sl+yeAear+rdPvyG++g PK29334.1 2 TCIFAPYFRSDEPKKFAKVHKVFGASNVSKILIEVPEEQREDTVNSLAYEAEARLRDPVYGCIG 65 6*************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	18.73	1	65	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	6.2E-27	2	65	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
XTCIFAPYFR SDEPKKFAKV HKVFGASNVS KILIEVPEEQ REDTVNSLAY EAEARLRDPV 60 YGCIG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	3e-30	3	65	26	88	LOB family transfactor Ramosa2.1
5ly0_B	3e-30	3	65	26	88	LOB family transfactor Ramosa2.1
Search in ModeBase

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010067553.1	2e-40	PREDICTED: LOB domain-containing protein 21
Refseq	XP_012457488.1	2e-40	PREDICTED: LOB domain-containing protein 21-like isoform X3
Swissprot	Q9SRL8	4e-33	LBD21_ARATH; LOB domain-containing protein 21
TrEMBL	A0A2P5EM60	3e-39	A0A2P5EM60_TREOI; Lateral organ boundaries domain containing protein
STRING	XP_010067552.1	8e-40	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5944	33	53

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G11090.1	2e-35	LOB domain-containing protein 21

Publications ? help Back to Top
Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing. Plant Physiol., 2007. 144(1): p. 32-42 [PMID:17351049]