PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK28790.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 192aa MW: 22068.2 Da PI: 7.5061 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 86.9 | 1.1e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k ienk rqvtf+kRr g++KKA+ELSvLCd+e+ +i+fs +g+lye++s PK28790.1 9 KLIENKQSRQVTFAKRRSGLMKKAHELSVLCDVEIGLIVFSGNGRLYEFCS 59 569**********************************************96 PP | |||||||
2 | K-box | 23.8 | 1.9e-09 | 105 | 163 | 42 | 100 |
K-box 42 dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 d+e L++ eL + e+qLe l+ R++K +l++e +++l +ek+l+ee++ L++k+ee PK28790.1 105 DVEHLTVDELAHKERQLEALLRLTRQRKAQLMMETVSTLSDQEKQLREEKQLLENKIEE 163 7899****************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.6E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.431 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.37E-36 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 8.24E-31 | 2 | 84 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-25 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 8.556 | 67 | 167 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.2E-8 | 105 | 161 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MGRGKVEMKL IENKQSRQVT FAKRRSGLMK KAHELSVLCD VEIGLIVFSG NGRLYEFCSG 60 HSLGNTIERY KTKGKEEKSS NELENCDYDG LWEDVDLLKG VSNLDVEHLT VDELAHKERQ 120 LEALLRLTRQ RKAQLMMETV STLSDQEKQL REEKQLLENK IEEMVGERGK KVEANEVKGN 180 APNSMRRVLQ LY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024023308.1 | 1e-56 | truncated transcription factor CAULIFLOWER A isoform X1 | ||||
TrEMBL | A0A2P5ARC8 | 5e-72 | A0A2P5ARC8_PARAD; MADS-box transcription factor | ||||
STRING | XP_009344924.1 | 5e-46 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03710.3 | 4e-37 | MIKC_MADS family protein |