PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK27149.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 95aa MW: 11183.3 Da PI: 10.6451 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 53.3 | 5.9e-17 | 28 | 80 | 5 | 57 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 ++ rr+++NRe+ArrsR RKk +eeL+e v +L+aeN++Lk++l ++ +++ PK27149.1 28 RKLRRMISNRESARRSRWRKKRHLEELTEQVNQLKAENRDLKNRLGHMAQQCH 80 6789*******************************************999996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.0E-17 | 24 | 88 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.9E-14 | 25 | 80 | No hit | No description |
PROSITE profile | PS50217 | 11.438 | 26 | 78 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.06E-13 | 28 | 81 | No hit | No description |
Pfam | PF00170 | 6.4E-14 | 28 | 80 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 4.84E-15 | 29 | 80 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 31 | 46 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
XELWSLLQPG TNSGSEGSSR AVYSVDERKL RRMISNRESA RRSRWRKKRH LEELTEQVNQ 60 LKAENRDLKN RLGHMAQQCH VAWTENDRLS SEFLA |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021821617.1 | 9e-41 | basic leucine zipper 4 | ||||
TrEMBL | A0A2P5CWW1 | 2e-46 | A0A2P5CWW1_PARAD; Basic-leucine zipper transcription factor | ||||
STRING | XP_008220396.1 | 4e-39 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5996 | 30 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G18160.1 | 6e-19 | basic leucine-zipper 2 |