PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK27147.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Nin-like
Protein Properties Length: 895aa    MW: 100264 Da    PI: 5.7343
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK27147.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.65.8e-29586637152
     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                aek+i+l++l++yF++++kdAAk++gvc T+LKriCRq+GIkRWP+Rkik++
  PK27147.1 586 AEKTITLQVLRQYFAGSLKDAAKSIGVCSTTLKRICRQHGIKRWPSRKIKKV 637
                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.677576657IPR003035RWP-RK domain
PfamPF020426.6E-25589637IPR003035RWP-RK domain
SuperFamilySSF542772.7E-20820894No hitNo description
PROSITE profilePS500579.209826895IPR000299FERM domain
SMARTSM006666.5E-16827894IPR000270PB1 domain
PROSITE profilePS5174523.045827895IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.8E-21828894No hitNo description
CDDcd064079.90E-35829894No hitNo description
PfamPF005641.3E-17829893IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005856Cellular Componentcytoskeleton
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 895 aa     Download sequence    Send to blast
MEEGVLSPST ILGAPSEYPM DLDFMDELFL EGCWLETRDG SEYISQTSSS NPLFDPLFWP  60
TLETNGDLNA NPSQRSNQEG RQKSIFNESV GVSVLRALPP SQTINNAPNN PGVSEGLITE  120
NDEMRRKNWI GTKESQGPSS FVMEKLCRAL MYIKDVIRDK DILVQIWIPV DKEGRRVLTT  180
RDLPFALDDS CPKLARYRDI SVKYQFPAEE DSKGLIMGLP GRVFSGKVPE WTPDVRYFRN  240
DEYPRLMHAY QYDVRGTLAL PIFEQGSRIC LGVVEVIMTT QKIKYRPELE SVCKALEAVN  300
LKSSEVLSTH NVFNKYYQAA LPEIQQVLKS ACDTHRLPLA QTWVPCIYQA KEGCRHSDEN  360
YVQCVSTVDH ACYVADPHIQ GFHEACSEHH LLRGQGVVGG AFMTNQPCFS ADITLYPKTE  420
YPLSHHAMLF ELHAAVAIRL RSIHTGAADF VLEFFLPKDC TDPEEQKKML TSLSLIIQQC  480
CQSLRVVTEK ELEEEGDFQA NKVLTPSIDR PDTEICFQEV QQNETDLSLF TVEKTSDGRH  540
SKSSQNQRGS SLKPSDEYVE ECSTVGEGSF SNLGGVKTGE RRRTKAEKTI TLQVLRQYFA  600
GSLKDAAKSI GVCSTTLKRI CRQHGIKRWP SRKIKKVGHS LQKLQLVIDS VQGASGAFQI  660
DSFYSNFPEL ASPNVSGTSP FSTSKANDHP TPSCLQQPGE GSGGMYSAQA TTAAAAATSK  720
SSSTYSQSSS SSQCCSSRSQ QHPQTWNNMV TSSEDANGGE NSGDDVVLKR VRSEAELFAS  780
HEVDNNNLLP RSQSHISLME HRKSLKSGFP PSSVKNERRL TQQEGELQRV KVTYGEEKTR  840
FRIHNNWGFT DLQQEVGRRF GIQDMTTFTI KYLDDDSEWV LLTCDADLEE CFEVW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024020072.10.0protein NLP4-like
TrEMBLA0A221I0P50.0A0A221I0P5_TREOI; NIN-like transcription factor
STRINGXP_008237985.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein