PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK26896.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 213aa MW: 24164.2 Da PI: 9.3014 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 78.7 | 4.1e-25 | 10 | 56 | 2 | 48 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 rien rqvtf+kRr+g+lKKA+ELSvLCdae+ ++ifs +gkly+ PK26896.1 10 RIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLVIFSAHGKLYD 56 8********************************************97 PP | |||||||
2 | K-box | 61.4 | 3.5e-21 | 90 | 181 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ++++++ ++e++ Lk+eie Lq+ +R + G + ++++l eLq Le++Le + +iRs K++++ ++i+ l++ke l+ +nk+L+ k+ee PK26896.1 90 QTQSDQLDAKNEISMLKQEIEILQKGLRYMFGGGAGTMNLDELQILEKNLELWIYHIRSAKMDIMSQEIQLLKNKEGILKAANKYLQDKIEE 181 6677778899*******************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.801 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.3E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.06E-27 | 1 | 75 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.19E-39 | 2 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.0E-23 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.7E-22 | 92 | 179 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.926 | 95 | 185 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MARGKVQLRR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLVIFSA HGKLYDLATK 60 GTMQGLIEKY MKSTKGSLVA QADQQQPILQ TQSDQLDAKN EISMLKQEIE ILQKGLRYMF 120 GGGAGTMNLD ELQILEKNLE LWIYHIRSAK MDIMSQEIQL LKNKEGILKA ANKYLQDKIE 180 ENTTTASDLD FVPMMTTNNP YPLTILQNGI FQF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-15 | 1 | 70 | 1 | 69 | MEF2C |
5f28_B | 1e-15 | 1 | 70 | 1 | 69 | MEF2C |
5f28_C | 1e-15 | 1 | 70 | 1 | 69 | MEF2C |
5f28_D | 1e-15 | 1 | 70 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024023771.1 | 1e-120 | agamous-like MADS-box protein AGL12 | ||||
Swissprot | Q38841 | 7e-87 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A2P5CFE8 | 1e-123 | A0A2P5CFE8_TREOI; MADS-box transcription factor | ||||
STRING | XP_002526423.1 | 1e-107 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7566 | 31 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 3e-89 | AGAMOUS-like 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|