PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK26008.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 121aa MW: 13827 Da PI: 10.2819 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.3 | 2.6e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l+ ++ +G+g +W + ++++g++R++k+c++rw++yl PK26008.1 14 KGPWSPEEDTKLKAYIDTYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62 79**********************************************7 PP | |||||||
2 | Myb_DNA-binding | 40.1 | 8.6e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +++eEd ++ + G++ W+ Ia+ ++ gRt++++k++w++ PK26008.1 69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111 569******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.569 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.34E-27 | 11 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.9E-12 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.2E-25 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.40E-8 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 21.666 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 4.8E-11 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-11 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.5E-24 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.24E-8 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008285 | Biological Process | negative regulation of cell proliferation | ||||
GO:0035987 | Biological Process | endodermal cell differentiation | ||||
GO:0045597 | Biological Process | positive regulation of cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000021 | Biological Process | regulation of ion homeostasis | ||||
GO:2000067 | Biological Process | regulation of root morphogenesis | ||||
GO:0048226 | Cellular Component | Casparian strip | ||||
GO:0000975 | Molecular Function | regulatory region DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MGRAPCCDKA NVKKGPWSPE EDTKLKAYID TYGTGGNWIA LPQKIGLKRC GKSCRLRWLN 60 YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR 120 R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-26 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012065305.1 | 4e-84 | transcription factor MYB36 | ||||
Swissprot | Q9FKL2 | 2e-81 | MYB36_ARATH; Transcription factor MYB36 | ||||
TrEMBL | A0A067L5Z3 | 8e-83 | A0A067L5Z3_JATCU; MYB family protein | ||||
STRING | XP_008220419.1 | 4e-83 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF130 | 34 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G57620.1 | 9e-84 | myb domain protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|